Clone FI04781 Report

Search the DGRC for FI04781

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:47
Well:81
Vector:pFlc-1
Associated Gene/TranscriptNop56-RA
Protein status:FI04781.pep: gold
Sequenced Size:1768

Clone Sequence Records

FI04781.complete Sequence

1768 bp assembled on 2009-11-03

GenBank Submission: BT100237.1

> FI04781.complete
GGCTTGCTATGGTCACACTTGAAGTAAGCACGTGGGAAAACAACTGTAGC
AGCATCGTGGGTGTATAAAAATATATATTTCTTAATTAAATCGGCATATA
TTCGGCATAGACATGTCGAACCTGTATGTGCTGTACGAGCATGCGGCGGG
CTTCTCGCTCTTCTCCGTCAAGGAGTTCGAAGAGGTGTCCATGTTCCTGC
CCCAGGTGGAGTCCTCGGTGACGGACCTCGCCAAGTTCAACTCAATTGTT
AAGCTGGCTGGATTTGCACCTTTCAAGACGGCCATTGCCGCACTGGAAAA
CATCAATGCCATATCCGAGGGCATAGTGCCGCAGGATCTGCTCTCCTTCT
TGGATGACTTCTTTGCCAAGCTGAAGAAGAAGAAGTGCACCCTGGGTATT
GCGGATGCCAAGCTGGGAGCTGCAATCACCGAGGCCATTGGCGTCCAGTG
CAGTCACTTTGGAGTGGTTCCTGAGATTCTGCGCGGCGTGCGATTCCACT
TCGCTAAGCTGGTCAAGGGATTCACCGACAAGTCCGCTGGCGTTGCTCAG
CTGGGTCTGGGCCACAGCTACTCGCGTGCCAAGGTCAAGTTCAATGTTCA
TCGTTCCGACAACATGATCATCCAGTCGATTGCTTTGCTGGATCAGTTGG
ATAAGGACGTAAATACCTTCTCTATGCGGATACGCGAGTGGTACTCGTAT
CACTTCCCAGAACTGGTCAAAATCGTTCCCGACAATTACATGTTCGCCAA
GGCGGCCAAGTTCATCAAGGATCGCAAGAACCTCACGCAAGACCAGCTGG
AGGATCTTGAGAAGATCGTCATGGACTCCGCCAAGGCTCAGGCTATCATT
GATGCCGCCAAGATGTCCATGGGCATGGACATCTCCATTGTTGATCTGAT
GAACATTGAGCTGTTCGCAGAGCGCGTTGTCAAGCTTTCCGAGTACCGAA
AGAAACTGTCTACCTACTTGCACAACAAGATGAACTTGGTGGCACCCAAT
CTGCAGTCTTTGATTGGCGACCAGGTCGGTGCCCGCCTGATATCGCATGC
CGGCAGCTTGACTAATCTGGCCAAGTACCCAGCATCTACAGTACAAATCC
TGGGTGCCGAGAAGGCGCTCTTCCGTGCTCTAAAGACCCGCTCCAATACG
CCCAAGTATGGTCTTATCTATCACTCCTCGTTCATTGGTCGAGCTGGCCT
GAAGAACAAGGGTCGCATCTCTCGATTCCTGGCCAACAAGTGCTCCATCG
CGTCGCGTATCGATTGCTTCCTGGAACAGCCGACTAGCGTGTTTGGCGAA
ACTCTTAAGCAACAGGTCGAAGATCGCCTCAAGTTCTACGAGTCCGGCGA
TGTGCCGCGCAAGAACATTGAGGTAATGAAGGAGGCCATCGAGGCAGCTG
GTCAAGAGGCGGCAATCACTGTACAGTCCGAGAAAAAGAAGAAAAAGAAG
AAGCGAGCGGCTGAAGACGAGGGCGAGACGAATGGCGCCAGTAATGGAAA
CGGAGCAGCCGCCGAGGCGGAAAATGGCAATGGCAACGATGATGGAGAGC
CAAAGAAGAAGAAGAAAAAGAAGAACAAAAACAAGGAAGCGGTGGAGGCG
TAAATGTCTCTGTTACATTCAACTTAGTTTAAGTCCACACTATTATCTTT
TACTTACATGCTTCTTTTGTATTTCCTTTGACCCCCTGATGGATCGCATT
TCAAATAATAATAAACATATACTTTGGAGGGTATTCCCACCGGAATAAAA
TAAAAAAAAAAAAAAAAA

FI04781.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-RA 1810 Nop56-RA 17..1762 1..1746 8730 100 Plus
nop5-RA 1962 nop5-RA 1145..1258 1025..1138 210 78.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18242634..18243862 1746..518 5995 99.2 Minus
chr3R 27901430 chr3R 18243926..18244330 519..115 1995 99.5 Minus
chr3R 27901430 chr3R 18244493..18244607 115..1 545 98.3 Minus
chr2L 23010047 chr2L 6916641..6916828 1212..1025 220 74.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-RA 1491 CG13849-PA 1..1491 113..1603 7455 100 Plus
nop5-RA 1536 CG10206-PA 883..1070 1025..1212 220 74.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-RA 1746 CG13849-RA 1..1746 1..1746 8730 100 Plus
nop5-RA 1813 CG10206-RA 1015..1202 1025..1212 220 74.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-PA 496 CG13849-PA 1..452 113..1468 2048 100 Plus
nop5-PA 511 CG10206-PA 1..404 122..1354 800 42.8 Plus
Prp31-PA 501 CG6876-PA 100..336 614..1330 255 24.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22419095..22420323 1746..518 6145 100 Minus
3R 32079331 3R 22420387..22420791 519..115 2025 100 Minus
3R 32079331 3R 22420954..22421068 115..1 575 100 Minus
2L 23513712 2L 6917542..6917729 1212..1025 220 74.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22159926..22161154 1746..518 6145 100 Minus
3R 31820162 3R 22161218..22161622 519..115 2025 100 Minus
3R 31820162 3R 22161785..22161899 115..1 575 100 Minus
2L 23513712 2L 6917616..6917729 1138..1025 210 78.9 Minus
Blast to na_te.dros performed on 2014-11-27 02:56:53 has no hits.

FI04781.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:26:36 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18244493..18244607 1..115 98   Minus
chr3R 18243927..18244329 116..518 99 <- Minus
chr3R 18242629..18243861 519..1751 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-03 12:28:45 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1491 113..1603 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:16:53 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1491 113..1603 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:39:33 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1491 113..1603 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:36 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1491 113..1603 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-03 12:28:45 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1746 1..1746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:16:53 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1746 1..1746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:39:33 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1746 1..1746 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:36 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
Nop56-RA 1..1746 1..1746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:26:36 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22420954..22421068 1..115 100   Minus
3R 22420388..22420790 116..518 100 <- Minus
3R 22419090..22420322 519..1751 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:39:33 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18246676..18246790 1..115 100   Minus
arm_3R 18246110..18246512 116..518 100 <- Minus
arm_3R 18244812..18246044 519..1751 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:06:30 Download gff for FI04781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22161785..22161899 1..115 100   Minus
3R 22161219..22161621 116..518 100 <- Minus
3R 22159921..22161153 519..1751 99 <- Minus

FI04781.pep Sequence

Translation from 112 to 1602

> FI04781.pep
MSNLYVLYEHAAGFSLFSVKEFEEVSMFLPQVESSVTDLAKFNSIVKLAG
FAPFKTAIAALENINAISEGIVPQDLLSFLDDFFAKLKKKKCTLGIADAK
LGAAITEAIGVQCSHFGVVPEILRGVRFHFAKLVKGFTDKSAGVAQLGLG
HSYSRAKVKFNVHRSDNMIIQSIALLDQLDKDVNTFSMRIREWYSYHFPE
LVKIVPDNYMFAKAAKFIKDRKNLTQDQLEDLEKIVMDSAKAQAIIDAAK
MSMGMDISIVDLMNIELFAERVVKLSEYRKKLSTYLHNKMNLVAPNLQSL
IGDQVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYG
LIYHSSFIGRAGLKNKGRISRFLANKCSIASRIDCFLEQPTSVFGETLKQ
QVEDRLKFYESGDVPRKNIEVMKEAIEAAGQEAAITVQSEKKKKKKKRAA
EDEGETNGASNGNGAAAEAENGNGNDDGEPKKKKKKKNKNKEAVEA*

FI04781.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16568-PA 495 GF16568-PA 1..495 1..496 2423 96.4 Plus
Dana\GF14470-PA 512 GF14470-PA 1..404 4..414 821 42.5 Plus
Dana\GF23690-PA 501 GF23690-PA 100..358 168..429 236 24.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12519-PA 497 GG12519-PA 1..497 1..496 2485 98.6 Plus
Dere\GG23571-PA 508 GG23571-PA 1..404 4..414 832 42.5 Plus
Dere\GG15883-PA 501 GG15883-PA 100..358 168..429 241 25.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17505-PA 498 GH17505-PA 1..481 1..480 2346 93.4 Plus
Dgri\GH13163-PA 512 GH13163-PA 1..404 4..414 836 42.7 Plus
Dgri\GH14529-PA 503 GH14529-PA 104..362 168..429 210 24.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-PA 496 CG13849-PA 1..496 1..496 2488 100 Plus
nop5-PA 511 CG10206-PA 1..487 4..495 850 40.2 Plus
Prp31-PA 501 CG6876-PA 100..378 168..453 262 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10373-PA 500 GI10373-PA 2..500 1..496 2336 92.2 Plus
Dmoj\GI17742-PA 520 GI17742-PA 1..404 4..414 827 42.7 Plus
Dmoj\GI13100-PA 503 GI13100-PA 104..362 168..429 242 24.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23339-PA 500 GL23339-PA 1..500 1..496 2366 94 Plus
Dper\GL25602-PA 517 GL25602-PA 1..404 4..414 827 43 Plus
Dper\GL24782-PA 501 GL24782-PA 100..358 168..429 224 24 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Nop56-PA 503 GA12569-PA 1..503 1..496 2295 92.8 Plus
Dpse\GA28044-PA 517 GA28044-PA 1..404 4..414 829 43 Plus
Dpse\GA19924-PA 501 GA19924-PA 100..358 168..429 224 24 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23654-PA 496 GM23654-PA 1..496 1..496 2616 99.6 Plus
Dsec\GM13736-PA 509 GM13736-PA 1..404 4..414 822 42.2 Plus
Dsec\GM25514-PA 501 GM25514-PA 100..358 168..429 239 25.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18461-PA 496 GD18461-PA 1..496 1..496 2611 99.4 Plus
Dsim\GD22532-PA 510 GD22532-PA 1..404 4..414 826 42.5 Plus
Dsim\GD14529-PA 501 GD14529-PA 100..358 168..429 240 25.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22835-PA 498 GJ22835-PA 1..498 1..496 2335 93 Plus
Dvir\GJ17567-PA 518 GJ17567-PA 1..404 4..414 854 43 Plus
Dvir\GJ13847-PA 503 GJ13847-PA 104..362 168..429 240 24.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14188-PA 512 GK14188-PA 11..512 1..496 2337 93.2 Plus
Dwil\GK24250-PA 516 GK24250-PA 1..404 4..414 827 42.8 Plus
Dwil\GK20402-PA 504 GK20402-PA 103..361 168..429 247 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24041-PA 497 GE24041-PA 1..497 1..496 2490 98.8 Plus
Dyak\GE18393-PA 509 GE18393-PA 1..404 4..414 843 42.8 Plus
Dyak\GE22227-PA 501 GE22227-PA 100..358 168..429 241 25.3 Plus

FI04781.hyp Sequence

Translation from 112 to 1602

> FI04781.hyp
MSNLYVLYEHAAGFSLFSVKEFEEVSMFLPQVESSVTDLAKFNSIVKLAG
FAPFKTAIAALENINAISEGIVPQDLLSFLDDFFAKLKKKKCTLGIADAK
LGAAITEAIGVQCSHFGVVPEILRGVRFHFAKLVKGFTDKSAGVAQLGLG
HSYSRAKVKFNVHRSDNMIIQSIALLDQLDKDVNTFSMRIREWYSYHFPE
LVKIVPDNYMFAKAAKFIKDRKNLTQDQLEDLEKIVMDSAKAQAIIDAAK
MSMGMDISIVDLMNIELFAERVVKLSEYRKKLSTYLHNKMNLVAPNLQSL
IGDQVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYG
LIYHSSFIGRAGLKNKGRISRFLANKCSIASRIDCFLEQPTSVFGETLKQ
QVEDRLKFYESGDVPRKNIEVMKEAIEAAGQEAAITVQSEKKKKKKKRAA
EDEGETNGASNGNGAAAEAENGNGNDDGEPKKKKKKKNKNKEAVEA*

FI04781.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Nop56-PA 496 CG13849-PA 1..496 1..496 2488 100 Plus
nop5-PA 511 CG10206-PA 1..487 4..495 850 40.2 Plus
Prp31-PA 501 CG6876-PA 100..378 168..453 262 24.3 Plus