Clone FI04833 Report

Search the DGRC for FI04833

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:48
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG4404-RA
Protein status:FI04833.pep: gold
Sequenced Size:1710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4404 2008-12-18 5.12 accounting

Clone Sequence Records

FI04833.complete Sequence

1710 bp assembled on 2008-11-06

GenBank Submission: BT050566.1

> FI04833.complete
GAGTTTTGGTTGCGCGTTTGCTGCGAGCAGTTGCACTTGCACTTGCAATT
CTATTGCCGCGCCCCCTCCCCTTTTTTTCTGTGTCGCCCCCTTTGTTTTG
TTTTGCCTCTTTTCGTTCGCGCCCCCCGCCATCTGCACCGTCTGCAGAGC
AGCGCTCCTGGAATAACTGCATGTGCGATTCACCGTTCTAGTTGGCGGCG
TGCGTGCGTGTGCGAGCGAGCGAGACAGACAGAGGCATGTGCTGGGTCGC
AATGGCGCGCAAGGACGATCCCGTTTTCAATGTGCGGTTCGTGCAGTTCG
TGGAGAATCAGCCGTGCCTGTGGAACTACACGCATCCGGGCTACAGCAAG
AAGGAGGATGTGCAGAGGGCGTGGCAGCAGGTTGCCAACGATATCAAGGA
CACGGTTCGCAACTGTCGCGAGCGATGGCGCACCATAAGGAGCAGCTTCC
TGCGATCCCTGAAGCTGGCACGCACACAAACGGGACGCGGCAAGCGCAAA
TACTACCTATCGAAGTATCTTCAGTTTCTCGTTCCGTTCACCAAGTCGCG
ATCCTGCCACAAGCAGCTGCCGGGCATGGTGCTCCGCAAACCCGGCCAAG
CTGCCACTGCTCAGCAGGAAGATGAGGTGGTGGCGGCGGAGGAGGAGGCC
AAGGTGAGCGATGGTGAGATGCCGCTGGACGTTCAGGTGTCCGAGGAGGA
GCATCGTCGTAATCAGGAACAGGATCGGGAGCAACCCACCGCCTGTTTGC
CGCTCCGCCTGCATTCCATCAAAGTGGAGCACGATTCGTCAAATGCGAAC
CAGCAGCTGGAGCGGATGGTGAGCCAGCAGTCGCTGGTCTCGGTGCCCGC
CGCCGCGCTGGGCAATCACCTGGGCTGGTCGGATCTGACGCAGTGGTTCA
AGGGACATGGCAGCGGTCATCACAAGTTAACCACAACAACAACAACACCA
ACATCACCACCACCGCCGCCGCAGCCGGCTACGTCAGCTCTAAGTGTTTT
CACTGGCGGACCAGGAGGAGGTGGCTCACAACCGGATGCCGACTACTCCT
TTCTGATCAGCCTGCATCCGTACATCAAGGAGATGAACGGCAAGCAGAAT
CGAAAGTTTCGACAGAAGGTCGTCGGACTCATCGACGATATTCTGGATAA
CAAGGATGTCTAACTTGTACACGGAAAAAAAACCGAAGATGCTTACGTTT
CAGCGATGAAAATTACGATTTGTAAACGGCTCTATCAAAATTACCACACA
CAAGAGATGCATATTTTGAATGATTGTGCGGAAATATTCTACATACCAAA
TGCAACATTATTTCAAAACCAACATTTTCACCACTTTCAGATTTCATTCT
GGCCATCATATTGCTAACTTTTAGACAATGAACTTAGTTTTTAAATATTT
ATGTCTAAGTTAAGTGTGAACGTACATGAAATTTATATCGAAGTTTATAT
GCACTGCATCGAAATTTGTAAAGCGCCCAGTGGAACAGGATGAAATCACC
AGTTATGTGATATTTTCTCTCCGTGAAGAAAAAAAGCCACAAGAATCGAA
GAAAACACACCCAGTTGATAGAAAACGCCAACAGTGCCCATTTATTAGAT
GTGTAGAGCGTACTTTAATTACGCTTTTTATTGTTGTTGTTAAGCACACA
CACAAACACGAATTTGTTATTGTCGAATAAAACATTTAAACTACGAAAAA
AAAAAAAAAA

FI04833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-RA 1940 CG4404-RA 237..1932 2..1697 8465 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12794668..12795958 1695..405 6425 99.8 Minus
chrX 22417052 chrX 12796536..12796939 405..2 2020 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-RA 927 CG4404-PA 1..927 237..1163 4635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-RA 1696 CG4404-RA 3..1696 2..1695 8455 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-PA 308 CG4404-PA 1..308 237..1160 1350 100 Plus
CG3919-PB 302 CG3919-PB 18..96 279..530 178 38.1 Plus
CG3919-PC 318 CG3919-PC 18..96 279..530 178 38.1 Plus
CG3838-PB 435 CG3838-PB 54..146 267..548 175 33 Plus
CG3838-PA 435 CG3838-PA 54..146 267..548 175 33 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12903743..12905035 1697..405 6450 99.9 Minus
X 23542271 X 12905613..12906016 405..2 2020 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12911841..12913133 1697..405 6450 99.9 Minus
X 23527363 X 12913711..12914114 405..2 2020 100 Minus
Blast to na_te.dros performed 2014-11-27 04:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3548..3624 883..958 131 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2369..2421 910..964 116 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1521..1575 934..988 112 71.4 Plus

FI04833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:24:41 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12796536..12796939 1..405 99   Minus
chrX 12794668..12795957 406..1695 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:15 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..927 237..1163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:29 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..927 237..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:59 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..927 237..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:41 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..927 237..1163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:20 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 18..1713 1..1695 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:29 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 18..1713 1..1695 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:59 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..1696 1..1695 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 18:57:44 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 18..1713 1..1695 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:41 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
CG4404-RA 1..1696 1..1695 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:24:41 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
X 12905613..12906016 1..405 99   Minus
X 12903745..12905034 406..1695 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:59 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12799646..12800049 1..405 99   Minus
arm_X 12797778..12799067 406..1695 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:49 Download gff for FI04833.complete
Subject Subject Range Query Range Percent Splice Strand
X 12913711..12914114 1..405 99   Minus
X 12911843..12913132 406..1695 99 <- Minus

FI04833.pep Sequence

Translation from 236 to 1162

> FI04833.pep
MCWVAMARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVA
NDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVP
FTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQ
VSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSL
VSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATS
ALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLID
DILDNKDV*

FI04833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20883-PA 333 GF20883-PA 1..333 6..308 851 55.4 Plus
Dana\GF22772-PA 437 GF22772-PA 57..149 11..104 185 34.4 Plus
Dana\GF24603-PA 302 GF24603-PA 16..96 13..98 171 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19531-PA 313 GG19531-PA 1..313 6..308 1085 73.8 Plus
Dere\GG15683-PA 238 GG15683-PA 16..96 13..98 188 37.2 Plus
Dere\GG10039-PA 452 GG10039-PA 68..160 11..104 186 34.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17618-PA 356 GH17618-PA 1..356 6..308 713 47.6 Plus
Dgri\GH10671-PA 438 GH10671-PA 65..157 11..104 190 35.4 Plus
Dgri\GH17100-PA 369 GH17100-PA 50..133 13..98 189 40.2 Plus
Dgri\GH10040-PA 369 GH10040-PA 50..133 13..98 189 40.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-PA 308 CG4404-PA 1..308 1..308 1642 100 Plus
CG3838-PB 435 CG3838-PB 54..391 11..303 201 23.5 Plus
CG3838-PA 435 CG3838-PA 54..391 11..303 201 23.5 Plus
CG3919-PC 318 CG3919-PC 18..265 15..306 180 22.2 Plus
CG3919-PB 302 CG3919-PB 18..96 15..98 178 38.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16274-PA 406 GI16274-PA 1..141 6..119 555 73.8 Plus
Dmoj\GI16274-PA 406 GI16274-PA 237..406 164..308 261 43.6 Plus
Dmoj\GI11704-PA 367 GI11704-PA 36..119 13..98 198 40.2 Plus
Dmoj\GI11040-PA 462 GI11040-PA 75..167 11..104 180 34.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22959-PA 362 GL22959-PA 1..327 6..294 807 55.8 Plus
Dper\GL21014-PA 286 GL21014-PA 35..114 15..98 194 40.5 Plus
Dper\GL18916-PA 444 GL18916-PA 55..147 11..104 182 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18161-PA 341 GA18161-PA 1..341 6..308 873 56.7 Plus
Dpse\GA17773-PA 286 GA17773-PA 35..114 15..98 194 40.5 Plus
Dpse\GA17722-PA 445 GA17722-PA 55..147 11..104 182 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11525-PA 299 GM11525-PA 1..299 6..308 1199 83.6 Plus
Dsec\GM17547-PA 441 GM17547-PA 61..397 11..303 194 23.3 Plus
Dsec\GM25465-PA 306 GM25465-PA 24..114 13..101 187 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24528-PA 224 GD24528-PA 1..217 6..220 926 83.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11378-PA 358 GJ11378-PA 36..119 13..98 205 40.2 Plus
Dvir\GJ18309-PA 449 GJ18309-PA 65..157 11..104 181 34.4 Plus
Dvir\GJ13939-PA 1077 GJ13939-PA 7..94 15..100 157 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16390-PA 377 GK16390-PA 1..377 6..308 823 50.9 Plus
Dwil\GK12702-PA 371 GK12702-PA 17..100 15..98 192 36.9 Plus
Dwil\GK23864-PA 441 GK23864-PA 68..160 11..104 183 34.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16190-PA 334 GE16190-PA 1..334 6..308 1126 73.9 Plus
Dyak\GE22013-PA 321 GE22013-PA 16..130 13..140 189 32 Plus
Dyak\GE18854-PA 445 GE18854-PA 66..158 11..104 185 34.4 Plus

FI04833.hyp Sequence

Translation from 236 to 1162

> FI04833.hyp
MCWVAMARKDDPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVA
NDIKDTVRNCRERWRTIRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVP
FTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQ
VSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSL
VSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATS
ALSVFTGGPGGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLID
DILDNKDV*

FI04833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4404-PA 308 CG4404-PA 1..308 1..308 1642 100 Plus
CG3838-PB 435 CG3838-PB 54..391 11..303 201 23.5 Plus
CG3838-PA 435 CG3838-PA 54..391 11..303 201 23.5 Plus
CG3919-PC 318 CG3919-PC 18..265 15..306 180 22.2 Plus
CG3919-PB 302 CG3919-PB 18..96 15..98 178 38.1 Plus