Clone FI04923 Report

Search the DGRC for FI04923

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:49
Well:23
Vector:pFlc-1
Associated Gene/Transcriptcrp-RA
Protein status:FI04923.pep: gold
Sequenced Size:3552

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
crp 2008-12-18 5.12 accounting

Clone Sequence Records

FI04923.complete Sequence

3552 bp assembled on 2008-12-05

GenBank Submission: BT053689.1

> FI04923.complete
ACTCTGCTGTTTATCGCCGAATTGAACGCACGTAGCGGACCGGACGGATA
TCGCATCTTCCGATCGGAAAAATCGTACAGTGCAGCCAATTCGCCGTCTA
CAGAAATCTATTAGCGCGCGTGTGTTGGTGCCAGTGCGGTGGCAAATTAA
AACAAAAAACATCTGCGAATTTGAATACGCAAATCTCATGCTCACTAAGA
GCGCAAAAGTCATAGAGTGCAGAATAGTGAATTGAAGAACTTTTGGACGC
GCTAAGAGTCGCTCTCCATCCCCATCTCTCTCTCTCTCTCTTGTGTGTGC
AGTGCTAGTGTGTGCGAGTGTGAGTGAGACGGGCAAACAATTTGCCGCTA
AATACAAAAAGCAGCTGAGACCAGCTGACGCATGTGTATGTTCGAAATAC
AATAAAGTTAACAGGCTATAAATAAATTGCAAATGTTTATGTAGCCGTCA
AGCAGCAGCAGTAGCAGCGCAACAACAAAAACCACGTGGCACAGACATTT
TGGCCACGATAGTAAGCAAATACACAAACACGATTAAACATGTCCGCCGT
ACCGGTTGCCATCAAAACGGAGGAAGTTATTCTAGAGCACGCCGAATACA
ACAGCGCCGAGGAATTGGATGAGGAATTGCAATTGCAACTAGAGGATTCA
GGGGGTGAGAACTATCACATCGAGTTCGCCAGCGAGTCAGCTCATCAGGG
TTCTCAGCGTCGACAGTCGAGCATGAGCGGTACGAATACCTCCAAGGGTG
GAGGAGGAGGGGGCAGCGGGGCCTTGAGCGATGGAGACGGTTCGGGAAAG
CCCCTTGTGGACAGCGAGAAGCGAATGCGTCGGGAAATCGCCAACAGCAA
CGAGCGCAGACGCATGCAGAGCATCAATGCCGGATTCCAGAGTCTGCGAT
CCCTGCTCCCGAGACACGAAGGCGAGAAGTTGAGCAAGGCGGCCATCCTA
CAACAGACCTTCCAATACATTGTGGAACTGGAGAACCAGAAGACGCAGCT
GCTGACGCAGAACAGTGAACTGAAGCGACAGGTGGGCGAGCACGAGGCCG
GCGGTTCTGGCGATGGTGGTGGTACCAACTCCGGCGGAAACTACAATGAT
TCCAATGCCAGCGGGGGCAATTCCACGGCGGTGGCCATCAAGAAACGGAA
GCTGACTGATAACGTGATTAACATCCAGGCGATTAGTGACAGTTCCGACG
AAGGTCTGGGATCGATGTCTCCAGAGCCGATGACTCTGCTGACAGCCGGC
GGAGCGGCGGCCACCAAACTGAGCAATGCTGCTACTCTTCTGGCGGCCAA
GGAGCTGCATGAGTCGAAGAAGCAGTTGGAGAAGGAGCGCAGTCTGCGGC
GACTCCTCGAGGATGAGCTCCAGATGATCAAGCGGCAGCTGTACAGCGTG
GCAACCGCACCGCCCGGAACAGCTGTGGCCGCCGCATCCGGCGGCAGTAG
TGGCGCCTACATTCCACGTGAGGTCATCGAGCACACCGATAACTTTGTGC
GCAGCGAGGATTTGGAGGAACTTGGCGGCACTGTCTCGTATGTGGAAATC
GATGAAATGACTGGCCAGCAGCAGGTGGTCGTGTGCTCCAGCATCGAGGA
GCTGGAGGCCGATGCCGCTGCCGAGATCATAACCGAGGATCAGGTGCACG
AGGAGGTCATCCTGTCATCGAACAGCTCCACAGAGTCCGAGAACGAAGTG
AACGTGAACGCAATTGCCAAAGCCTATGCCGAAGGATGCACGTCGAGTGC
TGCGATGCTTCAGCCAATTCTGCAGGCGGCCATCAAGGCCACGCCCAAGG
TGGAGGTGGAACGCATCCACGAGAAGATTGTCAAGGTCAAGACGGAGAAG
CACGATCTGCCATCGATGCAGACCGCACCACACTATCAGCATTCTCATCG
CCAGAATCTAGAGACCATTGTCCAGGCCATCAGGCATCTGGAGGGCGATC
ACCTATTCGCGGACGGCAGTGGGGGCCAAGAAAAGTTTGGCCAGCAGCAG
AATCTCCAGCAGCATCACCACCAAATGTCTGGAGTTCACCACCAGCAGCT
GCAACACCATCGTCTGGCGCAGGATGCGCCGCTGGCCCTCACCACCACGG
GCAAGCAGCATGCGGCGCTGGCGGAGCTTCGACCCTTCCTTCAACTCAAG
AGCGGCGGCAACAAGCAGGTGATCATTACGGCCAAGACGGCCAAGGATTC
CGGCGGTTTGGTCTCCACGAGCACCAGCAGTACAGCGGTTACGCCGACGG
CGATCTTCAAGGTGCAAACAACGGGCGGTCATGGAAACGGCAGTCATTTA
CCAGCGGGCTCATCGACGGGCACCATAATCACTGGAAGCAATGGCAGCGG
TGGTGCCCAGCAGCTGACCATCACCACATCGTTGAAGCAGTGCCGACCGG
GCGTGATAGTGGCCAAGCAGTTGCCGTCGTCCTGATTCAATGGCCCCAAA
TCGGGAGCGGGATCGGGCAATAATGGAGCTGGAGTAAAAGCAGGAGGAAG
ATGTGGCGCCCAGCGTGGGGCAGGAGCTGTAACTGGAGCACGGGCTAGTA
TTAAAGGCGCTCGCCAGGACACAACATCCACACCGACGAAAGCAACCGCA
ACCACTCAACAACAATTTACTAAGCAAAATCATTTTGCTGCCTCCCCCCG
GCAACGTAACAGTAACAGCAACAGTAACAGTAAGAATAGTAACCTTATTG
TAAGCAGTAAAACTAGTAGCATCATCAGCAGCAGCAGCCACAGAAATGTT
AAAGAGACTGTTACCAAACAGAGGCAGAGGCAAAAGAATGTAAATTAGTA
AGAGTTTAACGAAACAAACAACAAAGAAAGTATGATAATACCAAGCAGAC
CTAAACAAATTTTGTATTTTTGGGATAATTATGATTTCAGTTCGAACTAA
ACCAGGACCTCCTTTTCCAAGCTTCAATCGCCAACAAACCACAATACATA
CATACATACAGCCACTGTAATTAAATGCAAAGAGTAAAATACAAATACCA
TTTGTTCATTTATTGGTTAAGAAACTAGAATTAACTAAGGAAACGTAAAA
ATACAAATGAGCAATTGATTTTGAACAACATAATAGAGCAGCAGGCAAGA
AACAGCATAACGACAAAAAAAAAACGAAACCGAAACAAAACAGAGTACAA
AAGAAACAAAAAAGAACGCAAATAGACATACAATTTATGAATTTTGTTTG
GTTAATTCTTTTGAATTGCATGGAAAAGCATTGGAAAAGCGCGAAAAACT
AAAAATTTGAACGTTGAACGAGATGCCGAAATTGTTTAAGCATGTTTAAT
TGATGATTCCTTGAACTCTATAAAAACCATCGCATTAATTTTTACCTTTT
TTTAAATTATTTTTTCGTATCTTTAATTTTAACGTTCATAGGCGTACATT
ATATACTTTTGAATGGAACTTATTGAGTTTTTGTTGATATATTTGTGTAA
AAAAATTTTAAGTCTAATTATGTAAGCGAGTGATGAGCGTAGGTGGTAAA
CATTAAACAAAGCAAGAAAACAAAACAAAACAAAACAAAAAAAAAAAAAA
AA

FI04923.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
crp-RA 4457 crp-RA 21..3571 1..3552 17705 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16263278..16265876 3536..937 12920 99.9 Minus
chr2L 23010047 chr2L 16285948..16286578 631..1 3155 100 Minus
chr2L 23010047 chr2L 16277720..16278027 939..632 1540 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
crp-RB 1896 CG7664-PB 1..1896 540..2435 9480 100 Plus
crp-RA 1896 CG7664-PA 1..1896 540..2435 9480 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
crp-RB 4402 CG7664-RB 3..3537 1..3536 17630 100 Plus
crp-RA 3537 CG7664-RA 3..3537 1..3536 17630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
crp-PB 631 CG7664-PB 1..631 540..2432 1934 100 Plus
crp-PA 631 CG7664-PA 1..631 540..2432 1934 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16264405..16267019 3552..937 13015 99.9 Minus
2L 23513712 2L 16287098..16287728 631..1 3155 100 Minus
2L 23513712 2L 16278862..16279169 939..632 1540 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16264405..16267019 3552..937 13025 99.9 Minus
2L 23513712 2L 16287098..16287728 631..1 3155 100 Minus
2L 23513712 2L 16278862..16279169 939..632 1540 100 Minus
Blast to na_te.dros performed 2014-11-27 05:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2294..2474 2556..2746 193 60.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6909 2652..2832 179 58.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2464 2649..2782 173 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6861 2649..2742 166 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2539 2520..2742 164 55 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2718 2520..2788 158 55.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6751..6922 2571..2743 150 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2253..2514 2470..2741 149 56.8 Plus
roo 9092 roo DM_ROO 9092bp 1071..1152 2661..2742 140 63.4 Plus
roo 9092 roo DM_ROO 9092bp 1085..1157 1992..2064 140 65.8 Plus
roo 9092 roo DM_ROO 9092bp 1060..1143 1991..2074 132 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2352..2467 1992..2110 128 58.8 Plus

FI04923.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:37:19 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16285948..16286578 1..631 100   Minus
chr2L 16277721..16278027 632..938 100 <- Minus
chr2L 16264158..16265874 939..2655 99 <- Minus
chr2L 16263714..16264069 2744..3099 100 == Minus
chr2L 16263310..16263646 3168..3504 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:34:01 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..1896 540..2435 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:13 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..1896 540..2435 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:39:29 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..1896 540..2435 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:19 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..1896 540..2435 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:34:01 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..3512 1..3513 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:13 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 1..3512 1..3513 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:39:29 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 3..3514 1..3513 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:19 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 3..3514 1..3513 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:19 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16287098..16287728 1..631 100   Minus
2L 16278863..16279169 632..938 100 <- Minus
2L 16264444..16267017 939..3513 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:39:29 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16287098..16287728 1..631 100   Minus
arm_2L 16278863..16279169 632..938 100 <- Minus
arm_2L 16264444..16267017 939..3513 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:49 Download gff for FI04923.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16287098..16287728 1..631 100   Minus
2L 16278863..16279169 632..938 100 <- Minus
2L 16264444..16267017 939..3513 99 <- Minus

FI04923.pep Sequence

Translation from 539 to 2434

> FI04923.pep
MSAVPVAIKTEEVILEHAEYNSAEELDEELQLQLEDSGGENYHIEFASES
AHQGSQRRQSSMSGTNTSKGGGGGGSGALSDGDGSGKPLVDSEKRMRREI
ANSNERRRMQSINAGFQSLRSLLPRHEGEKLSKAAILQQTFQYIVELENQ
KTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAI
KKRKLTDNVINIQAISDSSDEGLGSMSPEPMTLLTAGGAAATKLSNAATL
LAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAAS
GGSSGAYIPREVIEHTDNFVRSEDLEELGGTVSYVEIDEMTGQQQVVVCS
SIEELEADAAAEIITEDQVHEEVILSSNSSTESENEVNVNAIAKAYAEGC
TSSAAMLQPILQAAIKATPKVEVERIHEKIVKVKTEKHDLPSMQTAPHYQ
HSHRQNLETIVQAIRHLEGDHLFADGSGGQEKFGQQQNLQQHHHQMSGVH
HQQLQHHRLAQDAPLALTTTGKQHAALAELRPFLQLKSGGNKQVIITAKT
AKDSGGLVSTSTSSTAVTPTAIFKVQTTGGHGNGSHLPAGSSTGTIITGS
NGSGGAQQLTITTSLKQCRPGVIVAKQLPSS*

FI04923.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21721-PA 638 GF21721-PA 1..638 1..631 2129 83 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24179-PA 629 GG24179-PA 1..629 1..631 2723 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10096-PA 679 GH10096-PA 1..497 1..476 1621 75.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
crp-PB 631 CG7664-PB 1..631 1..631 3166 100 Plus
crp-PA 631 CG7664-PA 1..631 1..631 3166 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14377-PA 659 GI14377-PA 1..659 1..631 1932 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14101-PA 624 GL14101-PA 1..624 1..631 2260 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20511-PA 624 GA20511-PA 1..624 1..631 2257 79.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17917-PA 608 GM17917-PA 1..608 1..631 2711 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21926-PA 630 GD21926-PA 1..630 1..631 2802 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16254-PA 671 GJ16254-PA 1..671 1..631 2027 69.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24289-PA 700 GK24289-PA 1..700 1..631 1852 67.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19372-PA 632 GE19372-PA 1..632 1..631 2785 96.5 Plus

FI04923.hyp Sequence

Translation from 539 to 2434

> FI04923.hyp
MSAVPVAIKTEEVILEHAEYNSAEELDEELQLQLEDSGGENYHIEFASES
AHQGSQRRQSSMSGTNTSKGGGGGGSGALSDGDGSGKPLVDSEKRMRREI
ANSNERRRMQSINAGFQSLRSLLPRHEGEKLSKAAILQQTFQYIVELENQ
KTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAI
KKRKLTDNVINIQAISDSSDEGLGSMSPEPMTLLTAGGAAATKLSNAATL
LAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAAS
GGSSGAYIPREVIEHTDNFVRSEDLEELGGTVSYVEIDEMTGQQQVVVCS
SIEELEADAAAEIITEDQVHEEVILSSNSSTESENEVNVNAIAKAYAEGC
TSSAAMLQPILQAAIKATPKVEVERIHEKIVKVKTEKHDLPSMQTAPHYQ
HSHRQNLETIVQAIRHLEGDHLFADGSGGQEKFGQQQNLQQHHHQMSGVH
HQQLQHHRLAQDAPLALTTTGKQHAALAELRPFLQLKSGGNKQVIITAKT
AKDSGGLVSTSTSSTAVTPTAIFKVQTTGGHGNGSHLPAGSSTGTIITGS
NGSGGAQQLTITTSLKQCRPGVIVAKQLPSS*

FI04923.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
crp-PB 631 CG7664-PB 1..631 1..631 3166 100 Plus
crp-PA 631 CG7664-PA 1..631 1..631 3166 100 Plus