Clone FI04928 Report

Search the DGRC for FI04928

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:49
Well:28
Vector:pFlc-1
Associated Gene/Transcriptgt-RB
Protein status:FI04928.pep: gold
Sequenced Size:1792

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
gt 2008-12-18 5.12 accounting

Clone Sequence Records

FI04928.complete Sequence

1792 bp assembled on 2008-11-07

GenBank Submission: BT057998.1

> FI04928.complete
AGTTTGCGTTCGACATCGTCAGCGTGAAGATATAGCAACATCAGAGCTAG
ATCACCAGTCTATATAGCGTCAATCAGTTGGATTAAACCCAGAGACCATA
CACCGAACACCATGCTAATGCACGAGAAACTCATGGCCGGGCAGTTCTTC
GATCTCAAGACTGATCGCAAGCCCCTGATGCACCACCACCAGTACCAGCA
CCACCAGCAGCAACCACTGCACCACTTGCCGCACAGCCAATTGCCGGTTC
AGGGATCCTTGGGCCTACCCAAAATGGATCTGTACACGGCCTACGCCTAC
CAGCAGCAGTTGCTGGGAGCTGCCCTCAGTCAGCAGCAACAACAGCAACA
GCAGCAGCAGCAACATCAGCAGCTGCAGCAGCAGCATACCTCCTCTGCAG
AGGTCCTGGATCTTTCCCGTCGATGTGACAGCGTAGAGACACCCAGGAAG
ACTCCCTCGCCGTATCAAACAAGCTATAGCTACGGCAGTGGTTCCCCCTC
GGCTTCGCCCACCAGCAATCTTCTGTATGCCGCCCAAATGCAACAGCAGC
AACATCAGCAGCAACAACAGCAACAGCAGCAGCAGCAACAATTAGCCTCC
CTGTATCCCGCTTTTTACTACAGCAACATCAAGCAGGAGCAAGCCACGCC
CACTGCTGCTCCGCCCAAGGTTACACCAACCGCTAACCTTCTGCAAACCT
TTGCTGCCGCCTCTGCTGCGGCCGCCGCTGCTGCTGCCGCTTCTTCGACC
AACTCACCAAGACCCGCCAGCAACGCCAGCACCATGCAGATAGACGTTCT
GGAGAATCCCCTGTCACCGGCTGTTGAGGCCACCACGCCAACCACCTCCA
GCAGCGGCGAGGCGGGAAAGAACACCCGTCCCTTCAAGGCCTTTCCCCGG
GATCCCTTGGTCATAGCTGCCAATTTCGCAGCCACTGATGTCCTTTTGGA
CAATCCGCGAGTGGAGCGCTACACGGAATACCGGAAGCGAGTGCTTGAGC
AAATCCGCAGCTCCAACGGAGGATCGCGCACCGTAACCAACCCAAAAATG
CGAAGGACCAACTCAAGAAGTGGATCCGTCAACGAAGGCAGCTCCTCAAA
CAACAACAGCGAAAGCGAGGATCGCGCTGCTGCGGAGGAGTCAAGCGACT
GTGACTCCCAGGCGGGCAACTTCGAGAGCAAGTCCGCCACCAGCAGCTCC
AGCAACTTGGCTAACGCTACTGCAGCAAACTCGGGCATCAGCTCGGGCAG
CCAGGTTAAGGATGCCGCATACTACGAGAGGCGTCGCAAGAACAATGCTG
CCGCCAAGAAGTCCCGCGATCGCCGCCGCATCAAGGAGGATGAGATCGCC
ATCAGGGCCGCCTATCTGGAACGCCAGAACATCGAGCTCTTGTGCCAGAT
CGACGCCCTCAAGGTCCAGCTGGCCGCCTTCACCTCCGCCAAAGTAACCA
CCGCCTAAAGGTCCACTCCTCTCTTGATGCGTTGAACGCGAGGATCCGAA
TCGTATGTCCAGTTTTTGGGTCAGCTTATCTGTGAATAGTTTAGGGGGCT
CAACTTTCTTTTTTTTTTACACGCTCGCATTTAAGTACTTTAAGTCCTTG
GAGTATACGTTATATTTGGAAAATGTATTAGCTGTAGTGCATCTCGCAAT
CCCACCAGTTAACTATCAATGGAATCATCTATAGTTGTAGAAGTCCCAGC
TAGCTATTAATGTTTAACTTATAAGTGAATTTTTTTCATAGCCCTAAGGA
ATGAATTTCAATAAATTATCGAAAATAAAAAAAAAAAAAAAA

FI04928.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
gt.e 2763 gt.e 978..2755 1..1778 8890 100 Plus
gt.d 7084 gt.d 5299..7076 1..1778 8890 100 Plus
gt.b 6333 gt.b 4548..6325 1..1778 8890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2320988..2322601 1776..163 7935 99.4 Minus
chrX 22417052 chrX 6842929..6843237 1219..1527 1380 96.4 Plus
chrX 22417052 chrX 2322676..2322838 163..1 800 99.4 Minus
chrX 22417052 chrX 6843240..6843419 1580..1776 510 86.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
gt-RB 1347 CG7952-PB 1..1347 112..1458 6735 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
gt-RB 1780 CG7952-RB 5..1780 1..1776 8880 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
gt-PB 448 CG7952-PB 1..448 112..1455 1143 100 Plus
CG7786-PA 192 CG7786-PA 116..170 1258..1422 159 58.2 Plus
Pdp1-PI 232 CG17888-PI 159..216 1240..1413 155 51.7 Plus
Pdp1-PF 250 CG17888-PF 181..234 1252..1413 153 55.6 Plus
Pdp1-PO 264 CG17888-PO 195..248 1252..1413 153 55.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2427111..2428726 1778..163 8080 100 Minus
X 23542271 X 6950774..6951082 1219..1527 1395 96.8 Plus
X 23542271 X 2428801..2428963 163..1 815 100 Minus
X 23542271 X 6951085..6951266 1580..1778 520 86.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2435209..2436824 1778..163 8080 100 Minus
X 23527363 X 6958872..6959180 1219..1527 1395 96.7 Plus
X 23527363 X 2436899..2437061 163..1 815 100 Minus
X 23527363 X 6959266..6959364 1680..1778 405 93.9 Plus
X 23527363 X 6959183..6959254 1580..1651 345 98.6 Plus
Blast to na_te.dros performed 2014-11-27 09:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2387 741..701 115 75.6 Minus

FI04928.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:18:32 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2322676..2322838 1..163 99   Minus
chrX 2322434..2322600 164..330 98 <- Minus
chrX 2322225..2322377 387..539 98 == Minus
chrX 2320988..2322173 591..1776 96 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:19 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1347 112..1458 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:12 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1347 112..1458 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:00:52 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1347 112..1458 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:32 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1347 112..1458 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:01:14 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1776 1..1776 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:12 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 1..1776 1..1776 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:00:52 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 5..1780 1..1776 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:32 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 5..1780 1..1776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:18:32 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
X 2428801..2428963 1..163 100   Minus
X 2427113..2428725 164..1776 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:00:52 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2322834..2322996 1..163 100   Minus
arm_X 2321146..2322758 164..1776 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:37 Download gff for FI04928.complete
Subject Subject Range Query Range Percent Splice Strand
X 2436899..2437061 1..163 100   Minus
X 2435211..2436823 164..1776 100 <- Minus

FI04928.pep Sequence

Translation from 111 to 1457

> FI04928.pep
MLMHEKLMAGQFFDLKTDRKPLMHHHQYQHHQQQPLHHLPHSQLPVQGSL
GLPKMDLYTAYAYQQQLLGAALSQQQQQQQQQQQHQQLQQQHTSSAEVLD
LSRRCDSVETPRKTPSPYQTSYSYGSGSPSASPTSNLLYAAQMQQQQHQQ
QQQQQQQQQQLASLYPAFYYSNIKQEQATPTAAPPKVTPTANLLQTFAAA
SAAAAAAAAASSTNSPRPASNASTMQIDVLENPLSPAVEATTPTTSSSGE
AGKNTRPFKAFPRDPLVIAANFAATDVLLDNPRVERYTEYRKRVLEQIRS
SNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAAEESSDCDSQ
AGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAKK
SRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLAAFTSAKVTTA*

FI04928.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21952-PA 456 GF21952-PA 1..456 1..448 1251 74.4 Plus
Dana\GF12658-PA 197 GF12658-PA 121..175 383..437 170 60 Plus
Dana\GF24150-PA 639 GF24150-PA 570..623 381..434 160 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12614-PA 444 GG12614-PA 1..444 1..448 1679 96 Plus
Dere\GG22289-PA 192 GG22289-PA 116..172 383..439 168 59.6 Plus
Dere\GG14935-PA 598 GG14935-PA 529..582 381..434 157 55.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17582-PA 457 GH17582-PA 1..457 1..447 1208 68.1 Plus
Dgri\GH21058-PA 187 GH21058-PA 112..166 383..437 170 63.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
gt-PB 448 CG7952-PB 1..448 1..448 2262 100 Plus
Smr-PF 3601 CG4013-PF 59..307 27..236 202 30.7 Plus
Smr-PE 3601 CG4013-PE 59..307 27..236 202 30.7 Plus
Smr-PD 3601 CG4013-PD 59..307 27..236 202 30.7 Plus
Smr-PG 3607 CG4013-PG 62..313 24..236 197 29.5 Plus
Smr-PF 3601 CG4013-PF 515..826 26..378 167 24.9 Plus
Smr-PE 3601 CG4013-PE 515..826 26..378 167 24.9 Plus
Smr-PD 3601 CG4013-PD 515..826 26..378 167 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15181-PA 507 GI15181-PA 1..507 1..447 1197 68.4 Plus
Dmoj\GI18660-PA 249 GI18660-PA 174..228 383..437 168 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14307-PA 495 GL14307-PA 1..495 1..448 1303 69.4 Plus
Dper\GL11555-PA 217 GL11555-PA 141..195 383..437 170 61.8 Plus
Dper\GL17823-PA 284 GL17823-PA 215..268 381..434 153 55.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20715-PA 493 GA20715-PA 1..493 1..448 1305 69.7 Plus
Dpse\GA20586-PA 219 GA20586-PA 143..197 383..437 170 61.8 Plus
Dpse\GA28498-PA 592 GA28498-PA 523..576 381..434 158 55.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18880-PA 445 GM18880-PA 1..445 1..448 1758 97.1 Plus
Dsec\GM20077-PA 192 GM20077-PA 116..170 383..437 166 60 Plus
Dsec\GM24985-PA 581 GM24985-PA 512..565 381..434 158 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15226-PA 192 GD15226-PA 116..170 383..437 167 60 Plus
Dsim\GD13032-PA 647 GD13032-PA 578..631 381..434 159 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17061-PA 491 GJ17061-PA 1..489 1..445 1159 64.4 Plus
Dvir\GJ21676-PA 192 GJ21676-PA 117..171 383..437 169 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17868-PA 445 GK17868-PA 1..445 1..448 1107 70.1 Plus
Dwil\GK20980-PA 196 GK20980-PA 120..174 383..437 167 61.8 Plus
Dwil\GK10510-PA 610 GK10510-PA 541..594 381..434 157 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16945-PA 448 GE16945-PA 1..448 1..448 1755 96.4 Plus
Dyak\GE14085-PA 192 GE14085-PA 116..170 383..437 166 60 Plus
Dyak\GE20386-PA 586 GE20386-PA 517..570 381..434 158 55.6 Plus

FI04928.hyp Sequence

Translation from 111 to 1457

> FI04928.hyp
MLMHEKLMAGQFFDLKTDRKPLMHHHQYQHHQQQPLHHLPHSQLPVQGSL
GLPKMDLYTAYAYQQQLLGAALSQQQQQQQQQQQHQQLQQQHTSSAEVLD
LSRRCDSVETPRKTPSPYQTSYSYGSGSPSASPTSNLLYAAQMQQQQHQQ
QQQQQQQQQQLASLYPAFYYSNIKQEQATPTAAPPKVTPTANLLQTFAAA
SAAAAAAAAASSTNSPRPASNASTMQIDVLENPLSPAVEATTPTTSSSGE
AGKNTRPFKAFPRDPLVIAANFAATDVLLDNPRVERYTEYRKRVLEQIRS
SNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAAEESSDCDSQ
AGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAKK
SRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLAAFTSAKVTTA*

FI04928.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
gt-PB 448 CG7952-PB 1..448 1..448 2262 100 Plus
Smr-PF 3601 CG4013-PF 59..307 27..236 202 30.7 Plus
Smr-PE 3601 CG4013-PE 59..307 27..236 202 30.7 Plus
Smr-PD 3601 CG4013-PD 59..307 27..236 202 30.7 Plus
Smr-PG 3607 CG4013-PG 62..313 24..236 197 29.5 Plus
Smr-PF 3601 CG4013-PF 515..826 26..378 167 24.9 Plus
Smr-PE 3601 CG4013-PE 515..826 26..378 167 24.9 Plus
Smr-PD 3601 CG4013-PD 515..826 26..378 167 24.9 Plus