Clone FI05204 Report

Search the DGRC for FI05204

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:4
Vector:pOT2
Associated Gene/TranscriptCG10639-RA
Protein status:FI05204.pep: gold
Sequenced Size:1815

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10639 2008-12-18 5.12 accounting

Clone Sequence Records

FI05204.complete Sequence

1815 bp assembled on 2008-08-15

GenBank Submission: BT044190.1

> FI05204.complete
TCACACTTATCAATTAGCGCGTTTATGATCGCCCCTCGGCCCCACAAATC
GCCCAGATGCTCGGCCCGTGAGCATATTTATTTTCTCTCGCCCCACGGAA
AACTTCCACGGGCTTCAGTCTGTCGATTCGCTCGAAAGCGCGCTGTACGC
ACAAGTTGGCGGAGGAGAAGGCAAGGTCAAGCAAGGTCTTTCTTTTCGGG
TTGGTAAATAATCTAAATTCTACGTGCGTGCGCGGGTGGTGAAAGCATAA
AAGAAAGAGAAATGGCTCAGGTGCGACTGCTGGTACAGGGACTTCGGCGT
AGCCTACTCAATGTGGGCGTGGCCGCGCCCAACGAATCCACAGCGACCCA
CAAAAGATCGCAGCACAGCTCGTCGAGCTGCGGAGATTATGATCTGGTTG
TCGTTGGTGGTGGCATCGTCGGCGCCGCATCTGCCCGGGAGATTGTCCTG
CGCCATCCATCCCTCAAAGTGGCTGTCCTGGAGAAGGAGTGCAAGCTGGC
AAAGCACCAGAGCGGCCACAACTCCGGCGTCATCCATGCTGGCATCTACT
ATAAGCCTGGAACCCTGAAAGCCCGCCTTTGCGTGGAGGGCATGCATTTG
GCCTACGCTTATCTGGATGAAAAAAAGATCCCGTACAAGAAAACCGGGAA
GCTAATTGTGGCCACGGATGAGAAAGAAGTGAAGCTGCTGAAGGATTTGG
AGAAGCGTGGCATTGCCAACAACGTACCGGATCTGCGAATGATCGAAGGC
AGCGAGATTCAGGAGATCGAACCCTACTGCCAGGGAGTGATGGCGCTCCA
CAGTCCGCACACTGGTATCGTTGACTGGGGATTGGTTACCGAGCATTATG
GTCAGGATTTCAAACAGTGCGGTGGTGATATCTACCTGGACTTCAATGTC
AGCAAGTTTACCGAGACCAAGGAGGGCACCGACTACCCAGTGACCATCCA
TGGCGCTAAGCCCGGTCAAACGGTTCGTACCAAGAACGTATTAACCTGTG
GCGGTTTGCAATCCGACCTGCTGGCTGAGAAGACTGGATGCCCCAGAGAC
CCCCGCATCGTGCCTTTCCGTGGAGAGTATCTGCTGCTGACCAAGGAAAA
ACAGCATATGGTCAAGGGTAATATTTATCCGGTGCCGGATCCACGTTTCC
CCTTCCTGGGAGTTCACTTTACGCCGCGAATGGACGGATCTATCTGGCTG
GGACCAAATGCCGTTCTGGCTCTGAAACGCGAAGGTTACACCTGGGGTGA
CATTAATCTTTTCGAGCTTTTCGACGCCCTGCGCTATCCGGGCTTCGTAA
AGATGGCGAGCAAGTACATCGGTTTCGGACTCAGCGAGATGTCCAAATCG
TGGTTCATTAACCTGCAGATCAAGGCGTTGCAGAAGTACATCCCGGATAT
TACGGAGTACGATATCCAGCGTGGTCCCGCTGGAGTACGTGCCCAAGCAA
TGGATCTGGATGGCAATCTGGTGGACGATTTTGTTTTCGATCGCGGACAA
GGATCGGGAGCGCTAGCCAAGCGAGTGCTTCACTGCAGAAACGCCCCATC
GCCGGGCGCTACTAGTAGCTTGGCCATTGCCAAGATGATCGCAGACAAGA
TCGAGAATGAGTTCTCTATCGGCAAGTGATGCCTCTATCCCAAATAATGT
AACCAAAGTCCAAAACTAAGTCCTATTTTCTGTTCTGCCTTTATGTCAGT
AATGTCTGTACTGATTCGCCACTATCGCATTTCTTTTCGAAACTGTAATA
TTGATCTATTGTGTATAAAACAAAATTAAAACTTGTGTAGGTTTCTAAAA
AAAAAAAAAAAAAAA

FI05204.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-RA 2067 CG10639-RA 226..2023 1..1798 8990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18971291..18972149 1241..383 4295 100 Minus
chr2L 23010047 chr2L 18970682..18971236 1796..1242 2760 99.8 Minus
chr2L 23010047 chr2L 18972606..18972988 383..1 1900 99.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-RC 1368 CG10639-PC 1..1368 262..1629 6840 100 Plus
CG10639-RB 1368 CG10639-PB 1..1368 262..1629 6840 100 Plus
CG10639-RA 1368 CG10639-PA 1..1368 262..1629 6840 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-RC 1870 CG10639-RC 75..1870 1..1796 8980 100 Plus
CG10639-RA 1945 CG10639-RA 150..1945 1..1796 8980 100 Plus
CG10639-RB 1685 CG10639-RB 1..1685 112..1796 8425 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-PC 455 CG10639-PC 1..455 262..1626 2261 100 Plus
CG10639-PB 455 CG10639-PB 1..455 262..1626 2261 100 Plus
CG10639-PA 455 CG10639-PA 1..455 262..1626 2261 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18972602..18973460 1241..383 4295 100 Minus
2L 23513712 2L 18971991..18972547 1798..1242 2785 100 Minus
2L 23513712 2L 18973917..18974299 383..1 1915 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18972602..18973460 1241..383 4295 100 Minus
2L 23513712 2L 18971991..18972547 1798..1242 2785 100 Minus
2L 23513712 2L 18973917..18974299 383..1 1915 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:25:39 has no hits.

FI05204.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:46:20 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18972606..18972988 1..383 99   Minus
chr2L 18971291..18972148 384..1241 100 <- Minus
chr2L 18970682..18971236 1242..1796 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:20 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 1..1368 262..1629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:49 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 1..1368 262..1629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:43 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 1..1368 262..1629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:36 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 1..1368 262..1629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:20 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 1..1368 262..1629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:43 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 150..1945 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:49 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 150..1945 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:43 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 150..1945 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-15 16:24:10 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 150..1945 1..1796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:20 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 150..1945 1..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:46:20 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18973917..18974299 1..383 100   Minus
2L 18972602..18973459 384..1241 100 <- Minus
2L 18971993..18972547 1242..1796 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:43 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18973917..18974299 1..383 100   Minus
arm_2L 18972602..18973459 384..1241 100 <- Minus
arm_2L 18971993..18972547 1242..1796 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:55 Download gff for FI05204.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18973917..18974299 1..383 100   Minus
2L 18972602..18973459 384..1241 100 <- Minus
2L 18971993..18972547 1242..1796 100 <- Minus

FI05204.pep Sequence

Translation from 261 to 1628

> FI05204.pep
MAQVRLLVQGLRRSLLNVGVAAPNESTATHKRSQHSSSSCGDYDLVVVGG
GIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPG
TLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRG
IANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDF
KQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQ
SDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLG
VHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMAS
KYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLD
GNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENE
FSIGK*

FI05204.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14644-PA 453 GF14644-PA 1..452 1..455 2126 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21668-PA 455 GG21668-PA 1..455 1..455 2241 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11599-PA 452 GH11599-PA 13..450 20..455 1932 83.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-PC 455 CG10639-PC 1..455 1..455 2390 100 Plus
CG10639-PB 455 CG10639-PB 1..455 1..455 2390 100 Plus
CG10639-PA 455 CG10639-PA 1..455 1..455 2390 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17168-PA 455 GI17168-PA 28..453 30..455 1919 84.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19622-PA 461 GL19622-PA 1..461 1..455 2010 84.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10459-PA 461 GA10459-PA 1..461 1..455 2007 84.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17047-PA 455 GM17047-PA 1..455 1..455 2420 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21794-PA 455 GD21794-PA 1..455 1..455 2420 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17673-PA 468 GJ17673-PA 54..466 43..455 1942 88.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24330-PA 457 GK24330-PA 1..457 1..455 1979 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12689-PA 455 GE12689-PA 1..455 1..455 2265 95.8 Plus

FI05204.hyp Sequence

Translation from 261 to 1628

> FI05204.hyp
MAQVRLLVQGLRRSLLNVGVAAPNESTATHKRSQHSSSSCGDYDLVVVGG
GIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPG
TLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRG
IANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDF
KQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQ
SDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLG
VHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMAS
KYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLD
GNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENE
FSIGK*

FI05204.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-PC 455 CG10639-PC 1..455 1..455 2390 100 Plus
CG10639-PB 455 CG10639-PB 1..455 1..455 2390 100 Plus
CG10639-PA 455 CG10639-PA 1..455 1..455 2390 100 Plus