Clone FI05209 Report

Search the DGRC for FI05209

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:9
Vector:pOT2
Associated Gene/TranscriptDtg-RA
Protein status:FI05209.pep: gold
Sequenced Size:2465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6234 2008-12-18 5.12 accounting

Clone Sequence Records

FI05209.complete Sequence

2465 bp assembled on 2008-08-15

GenBank Submission: BT044191.1

> FI05209.complete
GCCAACGCGTTCGGTCGTGGTGCGTGGTAGTCGGATGAGTAGTGAATAAA
CCCCGTGAAAACCGGAGTCAAATCGAAGTTATAGCAACAGCTGAAAGTCT
CGAGAACAGGCGAATGCAGCTGTATTCCTTATCTACACATCCCGGTGTTT
CAGTATCTGTGTGCGCATCCCGTGTTTGATAGTCTTGCTGTGCCTTGTGC
GTGCGTGTGTGTTTGTGCGTGTTGGCCAGTTGATTTCGGGCCCGTCAAAC
TGGGAGCGACAACCTAATCAATCAGTCACTCAATATGGCCAGTATTTCTA
AGAGCCGCGCCAGCAGCTGCTCCTCCAGAAAGAGGCTGCATCTGCAACCG
GGATCGCTGCTCTGCGTGATCGTCTTCTGCCTGCTGGCTTCGTGCTCGGC
TCAGCCAATCGAGTCAACCTCATTGCCTGCAGAAGTGGACGATGTGGAGG
GTACCACAATACTTCCCATCCAGTTGGAGGAGAGTTCACCAACACCAGAA
CCCATTATCAAGAATGAAACAGCTACTGCTCTTCCTGTCGTGGAACTCAA
AGTAGCTGAATCTAATCCTGTAGATCCTGTTGAGGCTACGGATAATTTTG
TATCGGTTTACGGCGGAAATCTGGAGCAGGATATAAAGAACGACGTGAAC
AGCGAAGTGGAAGATGCGCCCTCTCCGGTGGAACCAATCATCGAGGAAGT
TCAAAAAGTGGCAGAAGCTGAACTTGAAAATCATGAAATTAAGCTTGCGG
TCCAAAGTGCTCGGGAGCCCAAATCCCTGGATGCTGAAGAGGAGTCAAAG
ACAATCGATGAAGATCGCTTGGAAAATCAAGATAAAGCGGAGACAGTAAC
GGATAACATTGCCGTTTCCAGTGAGCAGATGGAGAGCCACATCAGACCAT
TACCCAACGTGACCAGTGACCTGGTTTCCGTGATTCTCAACGAAGACAAA
GCCATCACTGAGCAACCGATCACCAAAACGAACCTTCTGGCTTTGGAGCA
GGAGCACGAGAAATTCGAGGAAATTGATGAAAGTACTACAGTGCCAGTTT
ATGAGGAGCCCAAGCACCAAGTCACCAAGAAACAAGGCGTTGAGGACCCA
TCTACCGTTGAAATTCCACCTGAGGTATCTGACGAACAACACTTTGATCC
TTCCGAGGAACCCCAGACTGTTCGCGACGAACGTAATCTTGAAGAGCACG
ACGACAACCAGAATGAGATAAATGAGAACATCATTGAAGGGGAGGAGGCT
CCAGCCAAAACGTCAACCACCGCAGGTCCCTTGGTCACCGTGGAACCCAC
TAAATCGATTACCGAGCCAAATGAGGAGATCGAGAAAAAGGCGGAAGCTG
AGGCTAAGGCGGAAATGGAGGAGCAAGTGGAGGTCAACACTCCTTCTGTA
GACGCAACTGTGGTGGCAGCGGATCCTGATGAAGCACAAGATGAAGTAAT
CGTTGCTGAAACAACAGTAGAAGCTATCACAGAAGCTGCCAAGATTGTTG
TGGAGGAGGAACCCAAGGAAGATGTTTCAGTTCAACAGGAGCATCTAAAG
GAACAAAGAGTCCAGACAGTTTCCGAGTCCAACCGTCAAGCAAGTCCCAC
CGAGGAACCAATCAAAGAAGTGATCTTTCCAAAAGGTGATGATGAATCCC
CGGTAGAAGGGGATAGCTCCGAATCGGATGAGAAACCAACTGAGAGAGCA
ATAGTGGATGACGACTCCTCGGAGGAGCAAAACGAGGACGTTGTGGATGA
GGGAAAGTCCTCTTCCGACGACAGCACCGCCACTCCGCTTGTCTCCTATC
CCCCACACGATGCTGGCCAAACCTTCGATAGCAACTCGGCTGACGAACAC
TCGGCCCAGCTGTCCGGAGCCACCAACTACCGGTCCACCCTGATCATAGC
CCTGTGCTCCGGCACAGCAGTGATCTTCATCGTGGCCTCGCTGGTCATCT
TCGTGGTTTCCTTCCAACGGCAGCACGGCACCTTGGACATTGAGATGCAG
GAACAGCGTTTGGGCAAGGATATTCAGGAAGAGGACAATGTCCAGATGAA
GCTGCTCGATGTGGATCTCTCGTCGCCCGTCATTCTGCCTATGGGCAACG
AGGAGACCGATGAATGCCTGTAGACTCTCTCAGCACGATGATGCCAACAC
CATGGTGCCCTGTAAATATTTATTAACTTTGAGATTTCGATAAAAAACTT
CAGGCTGTTTCTTTGGCCGGATGTTCATTTTGGTTACTAAATTGTTGACT
GAGAGCAGCTGCAAGCTAAGCAAACGAAAACTCGAATTGAAACGAAAGCA
TTTGCCATACTGTTTAATTTTAAATGCACTTTAGCCACTAAGAATTTGCA
AAAGTTCGACAAAAATATTTATATTTAGACTTTTATAGAGTTAAGCTCTT
TTTTATTGTGTCTGATGGAAAGTCAGAATAAATAATTTCGATTGGTCAAA
AAAAAAAAAAAAAAA

FI05209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG6234-RA 2635 CG6234-RA 143..2591 1..2449 12215 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8476456..8478152 745..2447 8120 98.6 Plus
chr3R 27901430 chr3R 8473340..8473747 1..408 2040 100 Plus
chr3R 27901430 chr3R 8476062..8476397 409..744 1665 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-RA 1839 CG6234-PA 1..1839 285..2123 9165 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-RA 2464 CG6234-RA 18..2464 1..2447 12205 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-PA 612 CG6234-PA 18..612 336..2120 2683 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12651208..12652912 745..2449 8495 99.9 Plus
3R 32079331 3R 12648075..12648482 1..408 2040 100 Plus
3R 32079331 3R 12650814..12651149 409..744 1680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12392039..12393743 745..2449 8495 99.8 Plus
3R 31820162 3R 12388906..12389313 1..408 2040 100 Plus
3R 31820162 3R 12391645..12391980 409..744 1680 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:14:39 has no hits.

FI05209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:26:22 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8476456..8478152 745..2447 98   Plus
chr3R 8476062..8476397 409..744 99 -> Plus
chr3R 8473340..8473747 1..408 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:23 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 1..1839 285..2123 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:51 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 1..1839 285..2123 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:13 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 1..1839 285..2123 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:37 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 1..1839 285..2123 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:22 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
Dtg-RA 1..1839 285..2123 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:47 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 16..2462 1..2447 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:51 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 16..2462 1..2447 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:13 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 18..2464 1..2447 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-15 16:23:49 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 16..2462 1..2447 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:22 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
Dtg-RA 18..2464 1..2447 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:26:22 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12651208..12652910 745..2447 99   Plus
3R 12650814..12651149 409..744 100 -> Plus
3R 12648075..12648482 1..408 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:13 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8476930..8478632 745..2447 99   Plus
arm_3R 8476536..8476871 409..744 100 -> Plus
arm_3R 8473797..8474204 1..408 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:58 Download gff for FI05209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12392039..12393741 745..2447 99   Plus
3R 12391645..12391980 409..744 100 -> Plus
3R 12388906..12389313 1..408 100 -> Plus

FI05209.pep Sequence

Translation from 284 to 2122

> FI05209.pep
MASISKSRASSCSSRKRLHLQPGSLLCVIVFCLLASCSAQPIESTSLPAE
VDDVEGTTILPIQLEESSPTPEPIIKNETATALPVVELKVAESNPVDPVE
ATDNFVSVYGGNLEQDIKNDVNSEVEDAPSPVEPIIEEVQKVAEAELENH
EIKLAVQSAREPKSLDAEEESKTIDEDRLENQDKAETVTDNIAVSSEQME
SHIRPLPNVTSDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEIDES
TTVPVYEEPKHQVTKKQGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDER
NLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEIE
KKAEAEAKAEMEEQVEVNTPSVDATVVAADPDEAQDEVIVAETTVEAITE
AAKIVVEEEPKEDVSVQQEHLKEQRVQTVSESNRQASPTEEPIKEVIFPK
GDDESPVEGDSSESDEKPTERAIVDDDSSEEQNEDVVDEGKSSSDDSTAT
PLVSYPPHDAGQTFDSNSADEHSAQLSGATNYRSTLIIALCSGTAVIFIV
ASLVIFVVSFQRQHGTLDIEMQEQRLGKDIQEEDNVQMKLLDVDLSSPVI
LPMGNEETDECL*

FI05209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17112-PA 623 GF17112-PA 2..623 3..612 1295 54.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19127-PA 608 GG19127-PA 1..608 1..612 2358 80.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18703-PA 668 GH18703-PA 274..668 181..612 776 48.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-PA 612 CG6234-PA 1..612 1..612 3067 100 Plus
Msp300-PE 9606 CG42768-PE 4131..4571 62..496 195 22 Plus
Msp300-PG 13540 CG42768-PG 4131..4571 62..496 195 22 Plus
Strn-Mlck-PT 7905 CG44162-PT 3581..4041 63..497 194 21.7 Plus
Strn-Mlck-PV 7944 CG44162-PV 3620..4080 63..497 194 21.7 Plus
Strn-Mlck-PT 7905 CG44162-PT 4226..4691 42..497 188 21.1 Plus
Strn-Mlck-PT 7905 CG44162-PT 3383..3846 72..497 187 21.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3493..3911 107..497 187 21.6 Plus
Msp300-PE 9606 CG42768-PE 8182..8586 65..496 182 25.3 Plus
Msp300-PG 13540 CG42768-PG 8182..8586 65..496 182 25.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 4556..5007 63..496 182 22.4 Plus
Msp300-PE 9606 CG42768-PE 4247..4672 42..496 181 23.3 Plus
Msp300-PG 13540 CG42768-PG 4247..4672 42..496 181 23.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3841..4301 63..497 174 20.3 Plus
Msp300-PE 9606 CG42768-PE 4369..4773 65..496 172 23.6 Plus
Msp300-PE 9606 CG42768-PE 5097..5488 64..458 172 22.7 Plus
Msp300-PG 13540 CG42768-PG 4369..4773 65..496 172 23.6 Plus
Msp300-PG 13540 CG42768-PG 5097..5488 64..458 172 22.7 Plus
Msp300-PE 9606 CG42768-PE 2732..3175 84..496 170 21.8 Plus
Msp300-PG 13540 CG42768-PG 2732..3175 84..496 170 21.8 Plus
Strn-Mlck-PT 7905 CG44162-PT 4751..5163 63..486 168 20.7 Plus
Msp300-PE 9606 CG42768-PE 4571..4975 65..496 165 22.9 Plus
Msp300-PG 13540 CG42768-PG 4571..4975 65..496 165 22.9 Plus
Msp300-PE 9606 CG42768-PE 3175..3541 65..459 162 25.7 Plus
Msp300-PE 9606 CG42768-PE 8283..8686 65..495 162 24.8 Plus
Msp300-PG 13540 CG42768-PG 3175..3541 65..459 162 25.7 Plus
Msp300-PG 13540 CG42768-PG 8283..8686 65..495 162 24.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22850-PA 773 GI22850-PA 652..773 491..612 507 79.5 Plus
Dmoj\GI22850-PA 773 GI22850-PA 13..366 6..298 305 34.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27146-PA 611 GL27146-PA 39..611 25..612 1030 49.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19462-PA 603 GA19462-PA 38..603 30..612 1025 49.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24053-PA 611 GM24053-PA 17..611 18..612 2692 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18852-PA 612 GD18852-PA 1..612 1..612 2656 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14151-PA 631 GJ14151-PA 53..631 37..612 776 42.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13722-PA 566 GK13722-PA 41..566 24..612 739 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26211-PA 611 GE26211-PA 1..611 1..612 2408 84.5 Plus

FI05209.hyp Sequence

Translation from 284 to 2122

> FI05209.hyp
MASISKSRASSCSSRKRLHLQPGSLLCVIVFCLLASCSAQPIESTSLPAE
VDDVEGTTILPIQLEESSPTPEPIIKNETATALPVVELKVAESNPVDPVE
ATDNFVSVYGGNLEQDIKNDVNSEVEDAPSPVEPIIEEVQKVAEAELENH
EIKLAVQSAREPKSLDAEEESKTIDEDRLENQDKAETVTDNIAVSSEQME
SHIRPLPNVTSDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEIDES
TTVPVYEEPKHQVTKKQGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDER
NLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEIE
KKAEAEAKAEMEEQVEVNTPSVDATVVAADPDEAQDEVIVAETTVEAITE
AAKIVVEEEPKEDVSVQQEHLKEQRVQTVSESNRQASPTEEPIKEVIFPK
GDDESPVEGDSSESDEKPTERAIVDDDSSEEQNEDVVDEGKSSSDDSTAT
PLVSYPPHDAGQTFDSNSADEHSAQLSGATNYRSTLIIALCSGTAVIFIV
ASLVIFVVSFQRQHGTLDIEMQEQRLGKDIQEEDNVQMKLLDVDLSSPVI
LPMGNEETDECL*

FI05209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-PA 612 CG6234-PA 1..612 1..612 3067 100 Plus
Msp300-PE 9606 CG42768-PE 4131..4571 62..496 195 22 Plus
Msp300-PG 13540 CG42768-PG 4131..4571 62..496 195 22 Plus
Strn-Mlck-PT 7905 CG44162-PT 3581..4041 63..497 194 21.7 Plus
Strn-Mlck-PV 7944 CG44162-PV 3620..4080 63..497 194 21.7 Plus
Strn-Mlck-PT 7905 CG44162-PT 4226..4691 42..497 188 21.1 Plus
Strn-Mlck-PT 7905 CG44162-PT 3383..3846 72..497 187 21.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3493..3911 107..497 187 21.6 Plus
Msp300-PE 9606 CG42768-PE 8182..8586 65..496 182 25.3 Plus
Msp300-PG 13540 CG42768-PG 8182..8586 65..496 182 25.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 4556..5007 63..496 182 22.4 Plus
Msp300-PE 9606 CG42768-PE 4247..4672 42..496 181 23.3 Plus
Msp300-PG 13540 CG42768-PG 4247..4672 42..496 181 23.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3841..4301 63..497 174 20.3 Plus
Msp300-PE 9606 CG42768-PE 4369..4773 65..496 172 23.6 Plus
Msp300-PE 9606 CG42768-PE 5097..5488 64..458 172 22.7 Plus
Msp300-PG 13540 CG42768-PG 4369..4773 65..496 172 23.6 Plus
Msp300-PG 13540 CG42768-PG 5097..5488 64..458 172 22.7 Plus
Msp300-PE 9606 CG42768-PE 2732..3175 84..496 170 21.8 Plus
Msp300-PG 13540 CG42768-PG 2732..3175 84..496 170 21.8 Plus
Strn-Mlck-PT 7905 CG44162-PT 4751..5163 63..486 168 20.7 Plus
Msp300-PE 9606 CG42768-PE 4571..4975 65..496 165 22.9 Plus
Msp300-PG 13540 CG42768-PG 4571..4975 65..496 165 22.9 Plus
Msp300-PE 9606 CG42768-PE 3175..3541 65..459 162 25.7 Plus
Msp300-PE 9606 CG42768-PE 8283..8686 65..495 162 24.8 Plus
Msp300-PG 13540 CG42768-PG 3175..3541 65..459 162 25.7 Plus
Msp300-PG 13540 CG42768-PG 8283..8686 65..495 162 24.8 Plus