Clone FI05217 Report

Search the DGRC for FI05217

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:17
Vector:pOT2
Associated Gene/Transcriptspz-RB
Protein status:FI05217.pep: gold
Sequenced Size:2073

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
spz 2008-08-15 Release 5.9 accounting
spz 2008-12-18 5.12 accounting

Clone Sequence Records

FI05217.complete Sequence

2073 bp assembled on 2008-08-14

GenBank Submission: BT044193.1

> FI05217.complete
CTCGTGCCGAATTCGGCACGAGGTGCGCTCTCGCTGTCGTGTGTTCTCGA
TCGCGAGAAATCCAAATCGAAATCGCAGTCGAAATCGAACTTGGTTAATG
CTTAACACTCTGCATGCCCGGGAGATATGGTGAAACTCTCGATCTGACCG
GAAAATCCCAGCGCGCGTCGCTATAAACACTTAAGATCGGTGGCAGATGG
TATCGGGCTTGAGGTCCATAAAAGCGCATTCATCTCGAGCTTTTCGTGTC
ACTCAAAGACGGCGCACAGAGCCGAAAAGTTGAAGACTCACATATCCTGC
GATCAGCTACTTGGATAGCCCATTGCCCAGTTGCAAGCCAAATCGGTTAT
AAACGATATCAATATCGCGGCATTTCATCAGAGCAACCAAATCGAACCGA
TCCGAAAACGGTTCCACTAAAGCGGCGAGAGCGAAACTAAAGTGAAAAGC
AAACCGACTAATTGAAGTGTCTGTCTGTGTGTCTCGCAAACGTGCAAAGG
AAACAAACAAAACGGAATAGCCAACATATCACACAGAGCCACCGCACAAA
ATATTTATAAATAAATAAGAGGCAACAGTAACACCAGCTACCAGTATAAA
GGCCCGGCATTAACATTTAGTCGTGCCAGTTTGTTTATTTTTTATATACG
CAAAGCCCATAAAAAGAAAAAAACGCACAGATCACTAAAAAACAACAGCA
GCCGGCGCTATAATAACAAAGTTGTAGAAATAAGAAAATTGGTATAAGAC
GCCACCGATCCGCCAATCACCTGCTATATACTATTACTAATCCCCGACGC
AGACGTTCGCCGTCCGCAGAATCTATATATATTTATAAATCCAATTGATT
AAGCCCGAGATCGAGCATGATGACGCCCATGTGGATATCGCTGTTCAAAG
TCCTGCTGCTGCTGTTCGCCTTCTTTGCCACGACGTCCGCGGACAGTGCA
CCCTTCATGCCCATACCCACCCAGCACGACGATCCGACCCAGAAACAGAA
ACAGAATCAGAATCAATCTCCGATACCCGAAACGAACCGCCATTACCATC
AGTATCACAGCCTGATCCAACCAGATCAGTACTTCAAAGTGCAGCGCTCC
CCGAATGGAAAGCTGAATCTGGTCTTTAACGATACGTTCGTATCTTTGCA
GAGGACGGACACGGAGGTGCAATCCGAACAGCCGATACCCCCCCGACATC
CATCGGATACCTTTGTCTTCCCCGATTCCCCCATAGCCAAGTATCGGCCA
CCACAATCCCCAGCTCGTCCTTTGAGGAATGACACTAAGGAGCACAATCC
CTGCGCCAAGGATGAAAGCCAACACCTTAGAAACTTCTGCACGAATGTGG
ACGACTATCCGGACCTTTCAGGCCTCACACATAAGCTAAAAAACAACTTC
GCCAAGTTCTTTAGCAACGATCTTCAGCCCACGGATGTGAGCTCTCGCGT
TGGTGGCTCAGATGAGCGATTCCTTTGCAGGAGCATCAGGAAGCTGGTGT
ACCCAAAAAAGGGCTTGAGGGCGGACGACACCTGGCAGTTAATTGTCAAT
AACGATGAGTACAAACAGGCCATCCAGATCGAAGAGTGCGAAGGAGCGGA
TCAACCCTGTGACTTTGCCGCCAACTTTCCGCAGAGCTATAATCCAATCT
GCAAGCAGCACTACACACAGCAGACCCTGGCCAGCATCAAGAGTGATGGC
GAACTGGACGTGGTGCAGAATTCCTTCAAGATCCCCTCCTGCTGCAAGTG
CGCGTTGAAGACTGGGTGATTCTGGAAAATGGGATTCTCCAGTCGATGGC
TGCGACAATGTGATATTGAGCAAGAAGTTTCACCCACCACAGAATGGCAG
GCCAAACTGATCAGTGGTCATTGATTTATTCTATAATCTGCTGAATCCAC
ACATAGACTAATGTGCATATTAATTTAGAGCTTTAAGTCGAGTCATTTTA
ACCATATTCGTGTCATATATTCATTTTTGGCTTCCACGTCTAATGCCTAA
GCTAGAAATGCAAGTAATTAGTCCTAGAATACAAACAAAACAAAACACAA
AACACAAAAAAAAAAAAAAAAAA

FI05217.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
spz-RB 2333 spz-RB 209..2259 23..2073 10090 99.4 Plus
spz-RA 2411 spz-RA 1197..2337 933..2073 5540 99 Plus
spz-RL 2074 spz-RL 38..1103 23..1088 5330 100 Plus
spz-RA 2411 spz-RA 209..1118 23..932 4550 100 Plus
spz-RL 2074 spz-RL 1162..1998 1237..2073 4020 98.6 Plus
spz-RL 2074 spz-RL 1104..1163 1152..1211 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22892191..22893104 932..23 4430 99.2 Minus
chr3R 27901430 chr3R 22889144..22889525 1591..1210 1865 99.2 Minus
chr3R 27901430 chr3R 22889653..22889930 1209..932 1375 99.6 Minus
chr3R 27901430 chr3R 22888133..22888369 2055..1819 1170 99.6 Minus
chr3R 27901430 chr3R 22888848..22889076 1820..1592 1130 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
spz-RB 903 CG6134-PB 1..903 867..1769 4425 99.3 Plus
spz-RA 981 CG6134-PA 145..981 933..1769 4095 99.3 Plus
spz-RD 822 CG6134-PD 202..822 1149..1769 3015 99 Plus
spz-RA 981 CG6134-PA 1..66 867..932 330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
spz-RB 2050 CG6134-RB 18..2050 23..2055 10030 99.6 Plus
spz-RA 2128 CG6134-RA 1006..2128 933..2055 5480 99.2 Plus
spz-RL 2058 CG6134-RL 18..1083 23..1088 5330 100 Plus
spz-RA 2128 CG6134-RA 18..927 23..932 4550 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
spz-PB 300 CG6134-PB 1..300 867..1766 1523 100 Plus
spz-PA 326 CG6134-PA 1..326 867..1766 1486 89.9 Plus
spz-PL 270 CG6134-PL 1..270 867..1766 1317 90 Plus
spz-PD 273 CG6134-PD 1..273 867..1766 1134 78 Plus
spz-PC 253 CG6134-PC 34..253 1110..1766 1123 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27069144..27070053 932..23 4550 100 Minus
3R 32079331 3R 27066099..27066480 1591..1210 1865 99.2 Minus
3R 32079331 3R 27066608..27066885 1209..932 1390 100 Minus
3R 32079331 3R 27065070..27065324 2073..1819 1200 98 Minus
3R 32079331 3R 27065803..27066031 1820..1592 1100 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26809975..26810884 932..23 4550 100 Minus
3R 31820162 3R 26806930..26807311 1591..1210 1865 99.2 Minus
3R 31820162 3R 26807439..26807716 1209..932 1390 100 Minus
3R 31820162 3R 26805901..26806155 2073..1819 1200 98 Minus
3R 31820162 3R 26806634..26806862 1820..1592 1100 98.6 Minus
Blast to na_te.dros performed on 2014-11-27 12:23:29 has no hits.

FI05217.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:45:31 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22892191..22893112 13..932 96   Minus
chr3R 22889653..22889929 933..1209 99 <- Minus
chr3R 22889144..22889525 1210..1591 99 <- Minus
chr3R 22888848..22889076 1592..1820 99 <- Minus
chr3R 22888158..22888367 1821..2030 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:33 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 1..903 867..1769 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:40 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 1..903 867..1769 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:04 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 1..903 867..1769 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:57 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 1..903 867..1769 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:45:31 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 1..903 867..1769 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:58 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 8..2023 13..2030 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:40 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 8..2023 13..2030 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:04 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 10..2025 13..2030 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:25 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 8..2023 13..2030 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:45:31 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 10..2025 13..2030 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:45:31 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27069144..27070061 13..932 99   Minus
3R 27066608..27066884 933..1209 100 <- Minus
3R 27066099..27066480 1210..1591 99 <- Minus
3R 27065803..27066031 1592..1820 98 <- Minus
3R 27065113..27065322 1821..2030 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:04 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22894866..22895783 13..932 99   Minus
arm_3R 22892330..22892606 933..1209 100 <- Minus
arm_3R 22891821..22892202 1210..1591 99 <- Minus
arm_3R 22891525..22891753 1592..1820 98 <- Minus
arm_3R 22890835..22891044 1821..2030 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:16 Download gff for FI05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26809975..26810892 13..932 99   Minus
3R 26807439..26807715 933..1209 100 <- Minus
3R 26806930..26807311 1210..1591 99 <- Minus
3R 26806634..26806862 1592..1820 98 <- Minus
3R 26805944..26806153 1821..2030 99 <- Minus

FI05217.pep Sequence

Translation from 866 to 1768

> FI05217.pep
MMTPMWISLFKVLLLLFAFFATTSADSAPFMPIPTQHDDPTQKQKQNQNQ
SPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTE
VQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDE
SQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDE
RFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDF
AANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG
*

FI05217.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22956-PA 363 GF22956-PA 95..360 19..298 593 48.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12145-PA 351 GG12145-PA 81..350 9..299 1111 72.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18954-PA 369 GH18954-PA 103..361 16..299 392 36.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
spz-PB 300 CG6134-PB 1..300 1..300 1628 100 Plus
spz-PA 326 CG6134-PA 1..326 1..300 1591 92 Plus
spz-PL 270 CG6134-PL 1..270 1..300 1422 90 Plus
spz-PD 273 CG6134-PD 1..273 1..300 1189 78 Plus
spz-PC 253 CG6134-PC 1..253 1..300 1181 78.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23281-PA 359 GI23281-PA 185..351 134..299 396 47.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23619-PA 403 GL23619-PA 124..402 19..299 687 52.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19380-PD 305 GA19380-PD 1..304 2..299 755 54 Plus
Dpse\GA19380-PK 331 GA19380-PK 1..330 2..299 727 49.9 Plus
Dpse\GA19380-PL 284 GA19380-PL 1..283 2..299 641 48.9 Plus
Dpse\GA19380-PH 258 GA19380-PH 1..257 2..299 561 45.4 Plus
Dpse\GA19380-PM 283 GA19380-PM 1..282 2..299 539 41.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10138-PA 316 GM10138-PA 90..316 23..300 1043 76.6 Plus
Dsec\GM13652-PA 169 GM13652-PA 1..169 132..300 867 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\spz-PA 350 GD18098-PA 94..350 23..300 1245 88.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24139-PA 367 GJ24139-PA 95..359 8..299 404 39 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12039-PA 389 GK12039-PA 124..382 7..298 352 35.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\spz-PA 313 GE10592-PA 87..312 23..299 702 52.6 Plus

FI05217.hyp Sequence

Translation from 866 to 1768

> FI05217.hyp
MMTPMWISLFKVLLLLFAFFATTSADSAPFMPIPTQHDDPTQKQKQNQNQ
SPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTE
VQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDE
SQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDE
RFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDF
AANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG
*

FI05217.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
spz-PB 300 CG6134-PB 1..300 1..300 1628 100 Plus
spz-PA 326 CG6134-PA 1..326 1..300 1591 92 Plus
spz-PL 270 CG6134-PL 1..270 1..300 1422 90 Plus
spz-PD 273 CG6134-PD 1..273 1..300 1189 78 Plus
spz-PC 253 CG6134-PC 1..253 1..300 1181 78.1 Plus