Clone FI05218 Report

Search the DGRC for FI05218

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:18
Vector:pOT2
Associated Gene/TranscriptCG3808-RA
Protein status:FI05218.pep: gold
Sequenced Size:2535

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3808 2008-08-15 Release 5.9 accounting
CG3808 2008-12-18 5.12 accounting

Clone Sequence Records

FI05218.complete Sequence

2535 bp assembled on 2008-08-14

GenBank Submission: BT044194.1

> FI05218.complete
TCACACTGTTGCATCTTCACGTGTTTTCTTTCTGTTTATATTTCATTTTC
CTTAATAAATCGGCTTCTTTTAAGCAAATGGAGTGTTTCAATGCGGAAAT
ACCAGCTGACGGAGTGGTTAATAGCATAGAGACCGAAGAGATTTCGGAAA
ATGTAGTGAAAGCTGATGAAACCACGCTGGCAAATGGTGAGGATGAAGCC
GGAAAAGCCGGCGAGGAATATGCTTACTTGGAGCGAAATGAATTCACTTC
GGAAATATTCAAAGTTGAAGTGAAGAACATGGGATATTTCGGTATTGGGG
AGTTTAAGAAGCTTTTGAGAAACACCCTCAAATTTGACGTGACCAAAATC
AAGGCTCCAACTCGAAAAGAGTTCGCCTTTGTGTGCTTCCGCAGTCAGGA
GGATCAACAAAGGGCCTTGGAGATCCTGAATGGATACAAATGGAAGGGAA
AGGTGTTGAAGGCTCATGTTGCCAAGGCCTCGGCCGATCCTCTACAGAAA
AAGCGAGCTGCCGAGGAACAGGAGTCGGAGAGAAAGCCCAAGAAACAACG
TACGGCGGTGGAAGCCACGTGTCCTCTGTCGCACATTGCCTACGACCAGC
AGATTAAACAAAAATCCGAGGAAATGTCGGCACTTCTGGCGAAATACACC
CAGGAACTTCGGAAGGTCAATCCGCGGGCAAAGCCCCACTTGGATAAGTT
CCAATTCCACGAGGTGCTTCCCTCACCCACCGTTAATGGGTATAGAAATA
AAAACGAGTTCACCGTGGGAAAGAACTCCGTAGGCGAAGTGGTTGTGGGC
TTCAGATTGGGCTGCTACAGCGATGGATCTGTGGAAGTAGCCGAGGTCGC
AGACTTGCCACATCTACCGGAGCAGGCCAAGTGGGCTGCTCGCAGTTTCC
AGGACTTGGTGAGGAAGTCCAAGTTCTTGCCCTTCAATCCGGACGGAAAT
ATTGGCCACTTCCGGCAGCTAATGGTGCGGTGCTCCAGTGCCACAGGTGA
ACTAATGCTGGTGGCGGGCATATACTCCTCGAACTTAAGTGAAGACGAAC
AAGTTGAACTTAAGCAAGAACTGAAGTCCTTCTACGAAGATCTGGCAAAT
GATGCTCCGTACAAATGCAGCTCTCTGTATTACCAAGATGTCAAGCATCG
GGAAGCAGGTCAGACGATTAATCCGGTGGAACACATTTCGGGCAGCACCC
ACATCACCGATACCATACAGGGTCTCCAGTTTCGAATCAGCCCACTGGCC
TTTTTCCAAATCAACACAGAAGGAGCCAACGTGTTGTATCAAAAGGCCAT
TGATCTAGTTGCTCCTACTAAGGACACAACTATGTTGGATATTTGCTGTG
GTACTGGCACCATTACCCTTGCGTTCGCCAAGCACTGCAAGAAAGTGATG
GGCGTGGAGATCGTCCCTGATGCGATTAAGGATGCCGAGTTTAATGCGGA
AGCGAATGGCATTAAAAATGCAAAGTTCTTTACAGGAAATGCAGATGATT
TCATCAAGAGTATGGTGCGCGAAGCTCTCTACGATCAGGAGCCGGGTAAA
CCATTGGATCTTATTGCCGTGGTGGATCCCCCCAGGGCTGGACTGCACCA
CCGCTCGATAGCCGCAATTCGATCAGCCGATGCCATCAATCGTCTGGTCT
ACGTCTCCTGCAATCCGCACAGTGCTAAGCGGAATTTCATCGAGCTGGCC
AGACCGGAGTCTAAGCAATACAAGGGGGAGCCATTCTACCCAAAGTCCGC
TGTGGCCGTTGACATGTTTCCCCACACCATGCACACCGAGCTGGTCATTC
TGTTCGAGCGTGAACCTAAAACAAAGGCGGATGAGAAGTCATCGCCAGCG
GAGGGAGCTGCACAGTCAAAGTCTGAGGCAACCGAAGAAGCTGTTAGCGA
GGAGAACACCACATCCGTAACGTGACGTGTTTGTTGCCGGGTCAGTTGCG
ATTCGCTGAGACACCCAATATGTCTCAGTACCTCCTATCTGCCGCGATGC
TGCCCTCTATCATTGTCTCTCTTTGTGGCGACTGCTCTACGACTTTTATT
GTTTTAAATTGATTTAATTGTATTTACGCTGTGCGACGGGGAGGAAGTGG
AAAAAGTGACAGAAGCGACTTCCTATTTAGCAAAAGACTAAGTTTAAAGC
CCTGTTCAACTCGACATAGTCCGACATCCCCATCAGTGTTATTCAGGCCT
CTGGAGGCCCCTGTGTGCGTGATAAGAATCGCTGCTCCGGTGGAAGTGTG
GTGCTCATAAAGTTCTCATAAAGGTGTAGAAACCGCGTGAAAAAACAGCT
GAGAGGTGCTACAAGTCCAACGCCCCCTCAAGGGCAAATTGATGAACAAC
GACCCTGACAACGATCATTGATCATGTCCGACCAGGTACCAGTTAACGAT
TATTTCATAGTCTAAACATATGTTCTATTGTTAAAAGTAGAAAGGGTAGT
ATTTAAAAGATGTTGACGTTGATATTGATCTATCAACCATATTAAAAGAT
TCGAAAATGACAAAAAAAAAAAAAAAAAAAAAAAA

FI05218.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-RA 2522 CG3808-RA 12..2522 1..2511 12555 100 Plus
CG18135-RB 2987 CG18135-RB 1..283 2103..2385 1415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18988540..18989837 1596..299 6385 99.5 Minus
chr3L 24539361 chr3L 18987469..18988040 2511..1940 2860 100 Minus
chr3L 24539361 chr3L 18988100..18988445 1942..1597 1715 99.7 Minus
chr3L 24539361 chr3L 18989892..18990191 300..1 1485 99.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-RA 1848 CG3808-PA 1..1848 78..1925 9240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-RA 2522 CG3808-RA 12..2522 1..2511 12555 100 Plus
CG18135-RB 2983 CG18135-RB 1..283 2103..2385 1415 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-PA 615 CG3808-PA 1..615 78..1922 3107 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18998946..19000243 1596..299 6490 100 Minus
3L 28110227 3L 18997875..18998446 2511..1940 2860 100 Minus
3L 28110227 3L 18998506..18998851 1942..1597 1730 100 Minus
3L 28110227 3L 19000298..19000597 300..1 1500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18992046..18993343 1596..299 6490 100 Minus
3L 28103327 3L 18990975..18991546 2511..1940 2860 100 Minus
3L 28103327 3L 18991606..18991951 1942..1597 1730 100 Minus
3L 28103327 3L 18993398..18993697 300..1 1500 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:24:07 has no hits.

FI05218.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:24:55 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18989893..18990191 1..299 99   Minus
chr3L 18988540..18989836 300..1596 99 <- Minus
chr3L 18988102..18988445 1597..1940 99 <- Minus
chr3L 18987469..18988039 1941..2511 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:34 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 1..1848 78..1925 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:11 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 1..1848 78..1925 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:20:52 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 1..1848 78..1925 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:27 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 1..1848 78..1925 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:55 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 1..1848 78..1925 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:17 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 12..2522 1..2511 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:11 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 12..2522 1..2511 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:20:52 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 12..2522 1..2511 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:41 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 12..2522 1..2511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:55 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 12..2522 1..2511 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:24:55 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19000299..19000597 1..299 100   Minus
3L 18998946..19000242 300..1596 100 <- Minus
3L 18998508..18998851 1597..1940 100 <- Minus
3L 18997875..18998445 1941..2511 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:20:52 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18993399..18993697 1..299 100   Minus
arm_3L 18992046..18993342 300..1596 100 <- Minus
arm_3L 18991608..18991951 1597..1940 100 <- Minus
arm_3L 18990975..18991545 1941..2511 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:24 Download gff for FI05218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18993399..18993697 1..299 100   Minus
3L 18992046..18993342 300..1596 100 <- Minus
3L 18991608..18991951 1597..1940 100 <- Minus
3L 18990975..18991545 1941..2511 100 <- Minus

FI05218.pep Sequence

Translation from 2 to 1924

> FI05218.pep
TLLHLHVFSFCLYFIFLNKSASFKQMECFNAEIPADGVVNSIETEEISEN
VVKADETTLANGEDEAGKAGEEYAYLERNEFTSEIFKVEVKNMGYFGIGE
FKKLLRNTLKFDVTKIKAPTRKEFAFVCFRSQEDQQRALEILNGYKWKGK
VLKAHVAKASADPLQKKRAAEEQESERKPKKQRTAVEATCPLSHIAYDQQ
IKQKSEEMSALLAKYTQELRKVNPRAKPHLDKFQFHEVLPSPTVNGYRNK
NEFTVGKNSVGEVVVGFRLGCYSDGSVEVAEVADLPHLPEQAKWAARSFQ
DLVRKSKFLPFNPDGNIGHFRQLMVRCSSATGELMLVAGIYSSNLSEDEQ
VELKQELKSFYEDLANDAPYKCSSLYYQDVKHREAGQTINPVEHISGSTH
ITDTIQGLQFRISPLAFFQINTEGANVLYQKAIDLVAPTKDTTMLDICCG
TGTITLAFAKHCKKVMGVEIVPDAIKDAEFNAEANGIKNAKFFTGNADDF
IKSMVREALYDQEPGKPLDLIAVVDPPRAGLHHRSIAAIRSADAINRLVY
VSCNPHSAKRNFIELARPESKQYKGEPFYPKSAVAVDMFPHTMHTELVIL
FEREPKTKADEKSSPAEGAAQSKSEATEEAVSEENTTSVT*

FI05218.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10790-PA 613 GF10790-PA 1..612 26..639 2455 74.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13433-PA 615 GG13433-PA 1..615 26..640 3109 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16956-PA 613 GH16956-PA 39..613 68..640 2390 78.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-PA 615 CG3808-PA 1..615 26..640 3171 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11815-PA 597 GI11815-PA 37..594 68..632 2377 78.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21966-PA 329 GL21966-PA 23..328 54..360 1283 83.1 Plus
Dper\GL21973-PA 296 GL21973-PA 5..246 370..611 1222 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17699-PA 631 GA17699-PA 1..581 26..611 2522 82.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14902-PA 615 GM14902-PA 1..615 26..640 3159 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12311-PA 605 GD12311-PA 1..601 26..626 3125 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13518-PA 603 GJ13518-PA 13..600 44..640 2428 77.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12558-PA 612 GK12558-PA 55..601 70..615 2360 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22531-PA 615 GE22531-PA 1..615 26..640 3089 93 Plus
Dyak\GE22791-PA 615 GE22791-PA 1..615 26..640 3074 92.7 Plus

FI05218.hyp Sequence

Translation from 2 to 1924

> FI05218.hyp
TLLHLHVFSFCLYFIFLNKSASFKQMECFNAEIPADGVVNSIETEEISEN
VVKADETTLANGEDEAGKAGEEYAYLERNEFTSEIFKVEVKNMGYFGIGE
FKKLLRNTLKFDVTKIKAPTRKEFAFVCFRSQEDQQRALEILNGYKWKGK
VLKAHVAKASADPLQKKRAAEEQESERKPKKQRTAVEATCPLSHIAYDQQ
IKQKSEEMSALLAKYTQELRKVNPRAKPHLDKFQFHEVLPSPTVNGYRNK
NEFTVGKNSVGEVVVGFRLGCYSDGSVEVAEVADLPHLPEQAKWAARSFQ
DLVRKSKFLPFNPDGNIGHFRQLMVRCSSATGELMLVAGIYSSNLSEDEQ
VELKQELKSFYEDLANDAPYKCSSLYYQDVKHREAGQTINPVEHISGSTH
ITDTIQGLQFRISPLAFFQINTEGANVLYQKAIDLVAPTKDTTMLDICCG
TGTITLAFAKHCKKVMGVEIVPDAIKDAEFNAEANGIKNAKFFTGNADDF
IKSMVREALYDQEPGKPLDLIAVVDPPRAGLHHRSIAAIRSADAINRLVY
VSCNPHSAKRNFIELARPESKQYKGEPFYPKSAVAVDMFPHTMHTELVIL
FEREPKTKADEKSSPAEGAAQSKSEATEEAVSEENTTSVT*

FI05218.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-PA 615 CG3808-PA 1..615 26..640 3171 100 Plus