Clone FI05221 Report

Search the DGRC for FI05221

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:21
Vector:pOT2
Associated Gene/TranscriptCG15814-RA
Protein status:FI05221.pep: gold
Sequenced Size:1905

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15814 2008-08-15 Release 5.9 accounting
CG15814 2008-12-18 5.12 accounting

Clone Sequence Records

FI05221.complete Sequence

1905 bp assembled on 2008-08-14

GenBank Submission: BT044195.1

> FI05221.complete
CAACGTTGGCCTCGAACGTTTCGTTTTCGATAATCAGAAAGCGCTGTCGT
AGCTAAAGTAAATAAAGGTTATGATAAAATAGCAACAATTTGGGAAAAAC
CCCATACTCAGGACAGCTGGTTCTAACAATCAGGTCGCGCTTGTATTTTT
GTGGCTCACGTCACACATACATGTATTCGTTTTTTCGGCCGCTGTGACAA
ATGGCAACGCCACTGCAGCTGGACAAGCACACAGGCATAAAATGTAATTA
TTTGTTTTCGTTTCACGAATTTCAAAGGTAAAAACCGATCGCAATACGTG
GTGGGCAAGATAACGCAGCGACGCAGACGACGAGTGGGACTGTCCGGCGG
ATTGGCGGCAGCGGGATACGGCGGATACAACGGCAATAAGATGCACCAGG
AGCACATGGACCTGCATGAGCCCGTGGACTTGAACAAGTCCCTGGACGAA
ATGACGCCGGAGGAGCGAATGCGAGCGCAGCATCAACTGATGGTGGAGAA
ACATCGCGGCCACGATGCCATGCACTCCGAGATGGTGATCATTCTGTTCG
TCACCCTGGTTATTGCCCAGATCATCCTGGTCGAGTGGAAGAAGCGGCAC
TACAGATCCTACGCTTTCGTCACCCTGCTGGCCATGTGGCTCATTCCGCT
GATCATCTCCTGCAGCTTCGGCTGGCTGCGCTTCATAATCATCTGGCTGG
TGTTCACCTGCATCACGGCACTGGTTATGCGACGGGCCATCAGCAAGCCC
ATCCAGGGCACAACGCCTAGGCTGGTCTACAAGTGGTTCTACTTCATCTA
CAAGCTCAGCTATGGCCTTGGCCTGGTGGGCTATCTGGTGATCATAGCCG
CCTTTCTGGGCATGAATTACATGTTCTCACAGCCACCAAACACATGGATG
GATGTGGGCCTGATGTTCTGCTTCTACGGCCTGTACATCGGCGTCCTGGG
GCGTGATATATCCGAGATATGTTCGGATAAGATGGCGGCAGCTATTGGCT
ACTACACACCTCAGGGTATTCCAACACGACATCTTGATCAGAATGTCTGC
GCAGTGTGTGGCAATCAGTTGCTGGTCTCGGAGAAGGAAGAGGGCGTCAT
TGAGAACACCTACAAGTTGTCTTGTAACCACGTATTCCACGAGTTCTGTA
TACGTGGTTGGTGCATTGTGGGCAAGAAGCAGACGTGTCCCTACTGCAAG
GAAAAGGTCGATCTCCAGAAGATGTTCCGCAATCCCTGGGAGAAGCCGCA
CGTTTTGTACGGTCGCCTGCTGGATTGGATTCGTTGGCTGGTGGCCTGGC
AGCCGCTCATCTTTTTCATAGTACAAGGCATCAACTGGATGCTGGGACTG
GAGTAGATCCTGATACCGGCACTAGCTTTCCTCGGCGTCTAGTCAAGCAC
ACACACTTCGGATTAAGTCCTGCACATGAAACCACACGGAAAACACGACG
ATGGAGAAACAACGACAGACCAACCTGGAGGGGCTGCGAAACACCCGCAC
CACTAGTACCGTCGCCGTTCATTCCCCCGCTCCCCTCCACGACTCCATTA
CATGAACCTGAACCATGATGACGATGACGGATGAAAGATCTGTAGACGAA
TGCCATTGCCATCCAATCTGTTTGCGGGTTTCCAGTTCTGTGTGTGGTTT
GCTTTTGGGCACCCAAATTTTCCTTTTCCATTGGAGTCTTTAATCGAAAC
GTAAATGCAATTTTGGATATATGTATCTATATCTATATATTATACGTAGC
TATGTATTTATGTACATATGTGTGCCTGTGTGTATGCCTCCTAGGTATTA
TTACCAATTTTATTTTCTTGATTTTACTTAATTGCACTCGAGCTGGTTAG
GAATATACATATACCAAAAAAAATCTATTGATAAAATAAAAAAAAAAAAA
AAAAA

FI05221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-RA 1925 CG15814-RA 35..1922 1..1888 9440 100 Plus
CG15814-RC 1781 CG15814-RC 166..1778 276..1888 8065 100 Plus
CG15814-RB 1736 CG15814-RB 123..1733 278..1888 8055 100 Plus
CG15814-RC 1781 CG15814-RC 35..169 1..135 675 100 Plus
CG15814-RB 1736 CG15814-RB 66..127 1..62 310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17737455..17738109 1887..1236 3180 99.4 Minus
chrX 22417052 chrX 17739256..17739693 438..1 2190 100 Minus
chrX 22417052 chrX 17738761..17739059 771..473 1495 100 Minus
chrX 22417052 chrX 17738167..17738402 1235..1000 1165 99.6 Minus
chrX 22417052 chrX 17738465..17738695 999..769 1140 99.6 Minus
chrX 22417052 chrX 17739124..17739160 473..437 185 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-RC 966 CG15814-PC 1..966 391..1356 4830 100 Plus
CG15814-RA 966 CG15814-PA 1..966 391..1356 4830 100 Plus
CG15814-RB 966 CG15814-PB 1..966 391..1356 4830 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-RA 1884 CG15814-RA 1..1884 4..1887 9420 100 Plus
CG15814-RC 1740 CG15814-RC 129..1740 276..1887 8060 100 Plus
CG15814-RB 1664 CG15814-RB 55..1664 278..1887 8050 100 Plus
CG15814-RC 1740 CG15814-RC 1..132 4..135 660 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-PC 321 CG15814-PC 1..321 391..1353 1682 100 Plus
CG15814-PA 321 CG15814-PA 1..321 391..1353 1682 100 Plus
CG15814-PB 321 CG15814-PB 1..321 391..1353 1682 100 Plus
CG15814-PD 301 CG15814-PD 1..301 451..1353 1572 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17848109..17848761 1888..1236 3265 100 Minus
X 23542271 X 17849908..17850345 438..1 2190 100 Minus
X 23542271 X 17849413..17849711 771..473 1495 100 Minus
X 23542271 X 17848819..17849054 1235..1000 1180 100 Minus
X 23542271 X 17849117..17849347 999..769 1155 100 Minus
X 23542271 X 17849776..17849812 473..437 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17856207..17856859 1888..1236 3265 100 Minus
X 23527363 X 17858006..17858443 438..1 2190 100 Minus
X 23527363 X 17857511..17857809 771..473 1495 100 Minus
X 23527363 X 17856917..17857152 1235..1000 1180 100 Minus
X 23527363 X 17857215..17857445 999..769 1155 100 Minus
X 23527363 X 17857874..17857910 473..437 185 100 Minus
Blast to na_te.dros performed 2014-11-27 10:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5360..5480 1744..1626 122 59 Minus
Osvaldo 1543 Osvaldo OSV 1543bp 263..299 665..629 113 78.4 Minus

FI05221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:51:06 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17739256..17739693 1..438 100   Minus
chrX 17739124..17739158 439..473 100 <- Minus
chrX 17738762..17739058 474..770 100 <- Minus
chrX 17738465..17738693 771..999 99 <- Minus
chrX 17738167..17738402 1000..1235 99 <- Minus
chrX 17737632..17738109 1236..1713 99 <- Minus
chrX 17737455..17737558 1787..1887 97 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:36 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RC 1..966 391..1356 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:56 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RC 1..966 391..1356 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:37 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RB 1..966 391..1356 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:02 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RB 1..966 391..1356 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:06 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RB 1..966 391..1356 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:36:06 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RA 1..1887 1..1887 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:56 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RA 1..1887 1..1887 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:37 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RA 1..1884 4..1887 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:35 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RA 1..1887 1..1887 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:06 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RA 1..1884 4..1887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:51:06 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
X 17849908..17850345 1..438 100   Minus
X 17849776..17849810 439..473 100 <- Minus
X 17849414..17849710 474..770 100 <- Minus
X 17849117..17849345 771..999 100 <- Minus
X 17848819..17849054 1000..1235 100 <- Minus
X 17848110..17848761 1236..1887 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:37 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17743941..17744378 1..438 100   Minus
arm_X 17743809..17743843 439..473 100 <- Minus
arm_X 17743447..17743743 474..770 100 <- Minus
arm_X 17743150..17743378 771..999 100 <- Minus
arm_X 17742852..17743087 1000..1235 100 <- Minus
arm_X 17742143..17742794 1236..1887 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:36 Download gff for FI05221.complete
Subject Subject Range Query Range Percent Splice Strand
X 17858006..17858443 1..438 100   Minus
X 17857874..17857908 439..473 100 <- Minus
X 17857512..17857808 474..770 100 <- Minus
X 17857215..17857443 771..999 100 <- Minus
X 17856917..17857152 1000..1235 100 <- Minus
X 17856208..17856859 1236..1887 100 <- Minus

FI05221.pep Sequence

Translation from 390 to 1355

> FI05221.pep
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVI
ILFVTLVIAQIILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFII
IWLVFTCITALVMRRAISKPIQGTTPRLVYKWFYFIYKLSYGLGLVGYLV
IIAAFLGMNYMFSQPPNTWMDVGLMFCFYGLYIGVLGRDISEICSDKMAA
AIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENTYKLSCNHVFH
EFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE*

FI05221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21173-PA 321 GF21173-PA 1..321 1..321 1668 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18159-PA 321 GG18159-PA 1..321 1..321 1714 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12568-PA 321 GH12568-PA 1..321 1..321 1564 92.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-PC 321 CG15814-PC 1..321 1..321 1754 100 Plus
CG15814-PA 321 CG15814-PA 1..321 1..321 1754 100 Plus
CG15814-PB 321 CG15814-PB 1..321 1..321 1754 100 Plus
CG15814-PD 301 CG15814-PD 1..301 21..321 1644 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16348-PA 321 GI16348-PA 1..321 1..321 1657 94.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14563-PA 273 GL14563-PA 1..272 1..272 1328 88.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13966-PA 321 GA13966-PA 1..321 1..321 1605 91 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22850-PA 321 GM22850-PA 1..321 1..321 1711 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24486-PA 127 GD24486-PA 1..127 1..127 663 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15686-PA 321 GJ15686-PA 1..321 1..321 1664 94.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25166-PA 321 GK25166-PA 1..321 1..321 1669 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15568-PA 321 GE15568-PA 1..321 1..321 1707 99.1 Plus

FI05221.hyp Sequence

Translation from 390 to 1355

> FI05221.hyp
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVI
ILFVTLVIAQIILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFII
IWLVFTCITALVMRRAISKPIQGTTPRLVYKWFYFIYKLSYGLGLVGYLV
IIAAFLGMNYMFSQPPNTWMDVGLMFCFYGLYIGVLGRDISEICSDKMAA
AIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENTYKLSCNHVFH
EFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE*

FI05221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-PC 321 CG15814-PC 1..321 1..321 1754 100 Plus
CG15814-PA 321 CG15814-PA 1..321 1..321 1754 100 Plus
CG15814-PB 321 CG15814-PB 1..321 1..321 1754 100 Plus
CG15814-PD 301 CG15814-PD 1..301 21..321 1644 100 Plus