Clone FI05222 Report

Search the DGRC for FI05222

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:22
Vector:pOT2
Associated Gene/TranscriptAdSL-RA
Protein status:FI05222.pep: gold
Sequenced Size:2313

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3590 2008-12-18 5.12 accounting

Clone Sequence Records

FI05222.complete Sequence

2313 bp assembled on 2008-08-28

GenBank Submission: BT044196.1

> FI05222.complete
CTCTTCCCTTGTGATTACGCACTATTGGCCCAGTGTTTTTGTGATTTATA
GTCCATAATCTCCTACATAGTATACCCAAAAATGGCTAGCAACTACGAGG
GCTACAAGTCGCCGCTGAGCACCCGGTACGCCAGCAAAGAGATGCAGTTC
CTCTTCAGTGACCAGAACAAGTTCTCCACCTGGCGCCGGTTGTGGGTGTG
GCTGGCGAAGGCGGAGAGCAGGCTGGGACTAGAGATCAGCGATGCCCAGA
TTGCCGAGATGGAGCTCCAGATCAGCAACATCGACTTTGAGGCGGCCGCC
GCCGAGGAGCGACTTACGCGCCACGACGTAATGGCCCACGTCCATGTCTT
TGCCAAACAGTGTCCCTCTGCTGCGCCGGTGATCCATTTGGGAGCAACCT
CGTGCTATGTGGGCGACAACACTGATCTGATTGTACTGAGGGACGCTCTT
AAACTGCTCCTTCCACGAGTCGCCAGCGTGATAGCTCGTCTAAGCCAGTT
TGCCCAGAGCTACAAGGATCAGCCCACGTTGGGATTCACCCATCTCCAGC
CTGCGCAGTTGACCACGGTTGGCAAGCGGGCGTGCCTGTGGATCCAGGAT
CTGATCATGGACGAACGCGCGCTGTCCCGCTGTTTAGAGGACCTGCGCTT
CCGTGGAGTCAAGGGAACTACTGGTACCCAGGCCTCGTTCCTGCAACTTT
TCAATGGGGATGGCGAGAAGGTGAAGCAGCTGGATCAGTTGGTCACCGAA
CTGGCTGGCTTCAAGAAGGCCTATGCGGTAACCGGTCAAACATACTCCCG
AAAGGTGGATGTGGAGATCGTGGCCGCGCTTGCCAGTCTCGGCACCACCA
TCCACAAGATGTGCTCCGATCTGCGCATCCTCGCTTCTCGCAAAGAGCTG
GAGGAGCCCTTCGAGAGCACTCAGATTGGCTCCTCGGCCATGCCGTACAA
GAGGAACCCTATGCGCTCGGAGCGTTGTTGCGCCCTGGCCCGTCACCTCA
TCACCTTGTTCAGCAGTGCTGCTAATACACATGCCACTCAGTGGCTGGAA
CGCACTCTGGATGACTCTGCCAACAGGAGGTTGACCCTATCCGAGGCCTT
CCTGGCTGCAGATGCCGCCCTGCTTACTCTGCTGAACATCTCGCAGGGAC
TGGTCGTTTACCCAAAGGTGATTGAACGGCACATTTCCCAAGAGCTGCCG
TTCATGTCCACAGAGAACATAATCATGGCCATGGTGAAGGCGGGAGGAGA
TCGCCAGGTGTGCCACGAGAAGATTCGCGTGCTGTCCCAGGAGGCCGGAG
CCCAGGTGAAGCAGCATGGCAAGGACAACGACCTCGTGGTTCGAGTGCGA
AAGGATCCCTACTTTTCGCCCATCCTGGAGCAACTGGACACCATACTGGA
TGCCAAAACCTTTACTGGACGTGCCAGCGACCAAGTGGGCGAGTTCGTCA
AGGAGGAAGTGGAACCCGTGCTGGCACGCTACTCCGAAGCCCTGAAGAAC
GTTCAAGACGTCAAACTGAACATCTAGATCTAGCCCATTATGTTGCCCTG
TTTTAATCACTGAATTTGATTTTGTAAAATACACACACACACACATTCGC
ACCCAATCAACTGCGTCAGCCACTGGATGCAGTCGACGTTATCACCTTTT
AGACTCATTGGGTCGATGGCAAGCAGACCCCCGGCGTGATTTGTCTTTCT
GTTTTTGTATTTTTGCCAGCTTATTTACAATTAAAGGCTAAAATCGAAAA
ACAAAACCACAAGCCTCGAATCGAACTCGAGTCGACGTTCTTGATCCGAG
TAAACATATACACATATTTGCCGCCTGTGCCTTTCCCGTTCGCCACTCGG
GCTGACATATCACGACTCCAATGCTGCCACGGCACAGTGGGTCTTCGGGT
CTCATGCCGCTTGCTTTACTTTTAATTATATTATACTACATATAAAACAT
AACAGTGCTGAGAATTTTCTTAGCGAGCGCATTTCTTAAACAGTTGCTAC
TGGCTTTAAGCAGCCGAATATCTTATGCTTTTGATCTTGTTTCCATAATT
AAGATTGTTTTTAATGAAAAATGAAATATCATATCACAATAAAAGTATAC
GAGCCCATAAAAGTAAGTGTACGAAGTGTACTGGTTTGCTAACCAGCAAT
GTCTCGCTGTTGCTAAATGGATTATCACATTTAATTGACTGCATTCAGAT
CAGATCAGATTGCAATGGGTTTATTAACTCAACGGTTGAACTATGTAAAT
GAATATGAAATATAATATAAATATTAAGTCGTATAGGTCAAAAACTAAAA
AAAAAAAAAAAAA

FI05222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3590-RA 2309 CG3590-RA 14..2309 1..2296 11480 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12843266..12845559 2296..1 11370 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
AdSL-RA 1446 CG3590-PA 1..1446 82..1527 7230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
AdSL-RA 2341 CG3590-RA 46..2341 1..2296 11480 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
AdSL-PA 481 CG3590-PA 1..481 82..1524 2362 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17018779..17021075 2297..1 11485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16759610..16761906 2297..1 11485 100 Minus
Blast to na_te.dros performed 2014-11-27 04:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dtei\I-element 5386 Dtei\I-element DTEII 5386bp 3494..3534 2054..2094 115 75.6 Plus

FI05222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:22:32 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12843266..12845559 1..2296 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:38 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 1..1446 82..1527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:36 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 1..1446 82..1527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:34:07 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 1..1446 82..1527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:15 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 1..1446 82..1527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:32 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
AdSL-RA 1..1446 82..1527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:16 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 14..2309 1..2296 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:36 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 14..2309 1..2296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:07 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 46..2341 1..2296 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:08:12 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
CG3590-RA 14..2309 1..2296 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:32 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
AdSL-RA 46..2341 1..2296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:22:32 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17018780..17021075 1..2296 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:07 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12844502..12846797 1..2296 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:04 Download gff for FI05222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16759611..16761906 1..2296 100   Minus

FI05222.pep Sequence

Translation from 81 to 1526

> FI05222.pep
MASNYEGYKSPLSTRYASKEMQFLFSDQNKFSTWRRLWVWLAKAESRLGL
EISDAQIAEMELQISNIDFEAAAAEERLTRHDVMAHVHVFAKQCPSAAPV
IHLGATSCYVGDNTDLIVLRDALKLLLPRVASVIARLSQFAQSYKDQPTL
GFTHLQPAQLTTVGKRACLWIQDLIMDERALSRCLEDLRFRGVKGTTGTQ
ASFLQLFNGDGEKVKQLDQLVTELAGFKKAYAVTGQTYSRKVDVEIVAAL
ASLGTTIHKMCSDLRILASRKELEEPFESTQIGSSAMPYKRNPMRSERCC
ALARHLITLFSSAANTHATQWLERTLDDSANRRLTLSEAFLAADAALLTL
LNISQGLVVYPKVIERHISQELPFMSTENIIMAMVKAGGDRQVCHEKIRV
LSQEAGAQVKQHGKDNDLVVRVRKDPYFSPILEQLDTILDAKTFTGRASD
QVGEFVKEEVEPVLARYSEALKNVQDVKLNI*

FI05222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17915-PA 481 GF17915-PA 1..481 1..481 2419 95.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16799-PA 481 GG16799-PA 1..481 1..481 2553 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16359-PA 481 GH16359-PA 1..481 1..481 2254 85.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
AdSL-PA 481 CG3590-PA 1..481 1..481 2432 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13754-PA 481 GI13754-PA 1..481 1..481 2258 88.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22992-PA 481 GL22992-PA 1..481 1..481 2296 89.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17542-PA 481 GA17542-PA 1..481 1..481 2314 90 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15393-PA 481 GM15393-PA 1..481 1..481 2377 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20259-PA 481 GD20259-PA 1..481 1..481 2561 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14098-PA 481 GJ14098-PA 1..481 1..481 2315 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13848-PA 481 GK13848-PA 1..481 1..481 2349 89.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26115-PA 481 GE26115-PA 1..481 1..481 2556 99.2 Plus

FI05222.hyp Sequence

Translation from 81 to 1526

> FI05222.hyp
MASNYEGYKSPLSTRYASKEMQFLFSDQNKFSTWRRLWVWLAKAESRLGL
EISDAQIAEMELQISNIDFEAAAAEERLTRHDVMAHVHVFAKQCPSAAPV
IHLGATSCYVGDNTDLIVLRDALKLLLPRVASVIARLSQFAQSYKDQPTL
GFTHLQPAQLTTVGKRACLWIQDLIMDERALSRCLEDLRFRGVKGTTGTQ
ASFLQLFNGDGEKVKQLDQLVTELAGFKKAYAVTGQTYSRKVDVEIVAAL
ASLGTTIHKMCSDLRILASRKELEEPFESTQIGSSAMPYKRNPMRSERCC
ALARHLITLFSSAANTHATQWLERTLDDSANRRLTLSEAFLAADAALLTL
LNISQGLVVYPKVIERHISQELPFMSTENIIMAMVKAGGDRQVCHEKIRV
LSQEAGAQVKQHGKDNDLVVRVRKDPYFSPILEQLDTILDAKTFTGRASD
QVGEFVKEEVEPVLARYSEALKNVQDVKLNI*

FI05222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
AdSL-PA 481 CG3590-PA 1..481 1..481 2432 100 Plus