Clone FI05228 Report

Search the DGRC for FI05228

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:28
Vector:pOT2
Associated Gene/TranscriptCG8726-RB
Protein status:FI05228.pep: gold
Sequenced Size:2651

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8726 2008-12-18 5.12 accounting

Clone Sequence Records

FI05228.complete Sequence

2651 bp assembled on 2008-08-28

GenBank Submission: BT044197.1

> FI05228.complete
AGTAAACAGTGAAAAAATATACTTGTGTCGAGTCCAATTGGACTGCGAAA
ACTGCATTAAACAAAGAGGTCAAAGACAATCTGCAAGTGGTAGTAGCTAG
AGAATTACTAGAAACTCGAGATATTCAGTGCAAAGACCAATCCATTCGGA
TCCTTGTGGAAAAGGGTGGAGGCCAGGCCCACACATACATACACTTTCAG
CAGCAGCGCAGCTCGCCGAGTGAAGTGGAAAATGTATCCAAAGGAGTCCA
ATGGCCGTTTTTGCGAGCAGATATGAACGGAAATTGCCAATTGACGACAC
CCAGGCGCTGAGCTGCGAGATAACCGCCGTCCAGGAGGTCGCCGGACATA
CGGAGTACCTGCTGCGCGTGTGGAGGGGCGCCAGCAACAAGAACTACTGG
ACCGTTTTGCGCCGCTATAATGACTTCGACCGACTGGACAAGTCTCTCCG
CGTCTCCGGCATCGAGCTGCCGCTGCCTCGCAAACGCATCTTTGGTAACA
TGCGCCCGGAGTTCATAGCTGAACGGAAGCAAGCCCTGCAAGAGTACATA
AACGCCGTACTAATGAATCCCATATTGGCATCCTCGCTGCCAGCCAAGCG
CTTTGTGGATCCCGAGAGTTACTCGCAGTCCTTTCACGACCATGCCGTGC
AGAATGCTATGCTCTGCCTGCGCAACGACACTACGTGGTCGCTGGGTGGA
AGTATGGGTGCCATAGGCTGGCGCCTCCGGAAGCACTACTTTAAGGTCAC
TACAAAGCCGCCGGAGAAGAGCAGCAACAAGCAACTGGTTAAGAGCGGTT
CACAGACCCATCAGAGCAAACATTTCGCCGCTGGGAGCAGCAATGGCAGC
GGTCACTCCATCGACGCCGGAACCTTGGATCCCGGGTCAGAGGTGGTGGC
TGAGTGGCTGGAGTACGGACCCGACAAGTTTATCGACGAAAAAGAAATCG
GGGGCATAATGAAAAGCCTGATGGGCCTGCAGCATCCGCACATCGAGCCC
GTTCTCCTGGCAGCCCACACCGAAAACGGTTGCCTGGTCATAAGAAAATT
CCACAAGCATGGTACTTTAAAGGATGTTTTGTGCATGGCCGCGAATCCAA
AGAATACATTTCTTAGCAAGTACGGCAATCCCAAGGGGCGCACTGCGCTT
TCAATGAAACAAGTGGCTACATATGGGAAGCAGATTCTAGAGGCCCTAAT
ATTTTTGCACTCGAAGGGATACGCATATGGTCATCTACATTCCGGAAACA
TAGTGATAGTCGACGATTGTGTTAAGCTACTGGACATCGAGAACTTTTTG
CTGGGCGTTCCAGCGTTTTACCGGCCATTTTTCATGCAGCACAGTAAAAT
CCATGCCATCGAGACCATTGATGTTTACTGTTTTGGTCATGTCCTCTTCG
AAATGGCCATGGGTTATCCTCTGCAGGAGTCTGTCGTGCGCCAGATCACC
GAATGTCCCGAAGCGCTGAAATGTCTTCTGGAGAGCATTCTTTCCAAGGA
AGCTTGCAAAGCTGGCCTGCCGACTCTGGAGCAATTGTTGGGTCACAGAT
TCTTCTTGCAATACGCTTCAACCGAGAGCGCCGGCGCCGCTGCCAATGCT
GAAAAGCCGTACTTTAAGCTATCATTGAACGCCAAGGAGCTGCTTAAGCA
GGCGGCTATCAAGAGCGAAAACCGCCTGCGGGACGAACAGAAGTCTGTGA
AGAACCAAAAGCGCATTGTGCGTGTCCAGGAACTGATGAGCTCCGAGGAG
GAGAAGCGGAAGTCCAAGCAGAAAGCCAAACTAGAGCACAAACAGTCGAA
GCTAAAGCAGCAAAGTTCAATCCAAACAAACAATGGACGCTTGTCGCTTG
TGGCTGCGACTGCAGCAGCAGCTTCCTCAAGCACCACGGTGGTTGGCGAG
TTATGTGGGACCGACTCCTTCAACCGCTCCGACAGCACACCCGAGGAGCC
CACCACACTGGCCGGCATCAAATCACCGCCGCTCACTCCGGGGCCACACT
TGGGCAGCATATATCAGCAGGAATTGCCGTCGACGACTGGCGCACCGGTG
GAACGGCAGTCCTCCACACCGAACATGCTGTCTGAGGATGCGGAGGGCGG
TGATGGCGACGAGCCAACACGCTCCGCTCTTCTGGAGTCCATCTGCAAGT
TTAACCGCGGATCGCTGCGCAAAGTGCGATCCAACGACTAGCTGCGGAAC
TGTGGGACGAATAAATATTACAATTTTTGGACCAAATGTGGCGTTATGAA
ATAACGATACCATCAAAAATAACTTGAACTAATCGAATTCCAAAAGCTAC
ATTTTAGAGGCATATTAAGAAACAGAATACTAGCAGATCGAAGACACCGC
TGAGCATAGAATAGTCCCAAAACAATCCAGCAATTACTATATGTATTAAC
GAAACCCACTGATTATAATTATTGCATCTTATACGTGTCCACCATACATT
GCATACGATTTATCGGCTAAAAAGCATGTGTCTATTTATGTAAGCAACAA
GTTACATGTCACTCACTTGCGATCAGATTCCCGATCGCAACTAAAGCTTT
ACCTATGTGTCCACTACACGACTGATACTAACTTTGGTACGAATATCTTA
AATGAAAAATGGAAACAAAGTATCTAAATCTAAAAAAAAAAAAAAAAAAA
A

FI05228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-RB 3382 CG8726-RB 62..2703 1..2642 13195 99.9 Plus
CG8726-RA 3417 CG8726-RA 448..2738 352..2642 11440 99.9 Plus
CG8726-RC 3516 CG8726-RC 448..1873 352..1777 7130 100 Plus
CG8726-RC 3516 CG8726-RC 1973..2837 1778..2642 4310 99.8 Plus
CG8726-RA 3417 CG8726-RA 62..414 1..353 1765 100 Plus
CG8726-RC 3516 CG8726-RC 62..414 1..353 1765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3856214..3856871 2631..1974 3230 99.4 Minus
chr2R 21145070 chr2R 3858169..3858578 1047..638 2050 100 Minus
chr2R 21145070 chr2R 3859031..3859383 353..1 1765 100 Minus
chr2R 21145070 chr2R 3857264..3857571 1777..1470 1540 100 Minus
chr2R 21145070 chr2R 3858639..3858925 638..352 1435 100 Minus
chr2R 21145070 chr2R 3857630..3857870 1469..1229 1205 100 Minus
chr2R 21145070 chr2R 3856969..3857164 1973..1778 980 100 Minus
chr2R 21145070 chr2R 3857925..3858108 1231..1048 920 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-RB 1941 CG8726-PB 1..1941 251..2191 9705 100 Plus
CG8726-RA 1692 CG8726-PA 1..1692 500..2191 8460 100 Plus
CG8726-RC 1323 CG8726-PC 1..1278 500..1777 6390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-RB 3336 CG8726-RB 16..2646 1..2631 13155 100 Plus
CG8726-RA 3371 CG8726-RA 402..2681 352..2631 11400 100 Plus
CG8726-RC 3470 CG8726-RC 402..1827 352..1777 7130 100 Plus
CG8726-RA 3371 CG8726-RA 16..368 1..353 1765 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-PB 646 CG8726-PB 1..646 251..2188 3026 100 Plus
CG8726-PA 563 CG8726-PA 1..563 500..2188 2592 100 Plus
CG8726-PC 440 CG8726-PC 1..410 500..1729 2065 100 Plus
Slob-PH 455 CG43756-PH 175..331 956..1423 236 37 Plus
Slob-PG 459 CG43756-PG 175..331 956..1423 236 37 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7968808..7969476 2642..1974 3330 99.9 Minus
2R 25286936 2R 7970774..7971183 1047..638 2050 100 Minus
2R 25286936 2R 7971636..7971988 353..1 1765 100 Minus
2R 25286936 2R 7969869..7970176 1777..1470 1540 100 Minus
2R 25286936 2R 7971244..7971530 638..352 1435 100 Minus
2R 25286936 2R 7970235..7970475 1469..1229 1205 100 Minus
2R 25286936 2R 7969574..7969769 1973..1778 980 100 Minus
2R 25286936 2R 7970530..7970713 1231..1048 920 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7970007..7970675 2642..1974 3330 99.8 Minus
2R 25260384 2R 7971973..7972382 1047..638 2050 100 Minus
2R 25260384 2R 7972835..7973187 353..1 1765 100 Minus
2R 25260384 2R 7971068..7971375 1777..1470 1540 100 Minus
2R 25260384 2R 7972443..7972729 638..352 1435 100 Minus
2R 25260384 2R 7971434..7971674 1469..1229 1205 100 Minus
2R 25260384 2R 7970773..7970968 1973..1778 980 100 Minus
2R 25260384 2R 7971729..7971912 1231..1048 920 100 Minus
Blast to na_te.dros performed on 2014-11-27 11:29:18 has no hits.

FI05228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:49:12 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3859032..3859383 1..352 100   Minus
chr2R 3858639..3858924 353..638 100 <- Minus
chr2R 3858169..3858577 639..1047 100 <- Minus
chr2R 3857927..3858108 1048..1229 100 <- Minus
chr2R 3857630..3857869 1230..1469 100 <- Minus
chr2R 3857264..3857571 1470..1777 100 <- Minus
chr2R 3856969..3857164 1778..1973 100 <- Minus
chr2R 3856214..3856871 1974..2631 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:42 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 1..1941 251..2191 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:08 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 1..1941 251..2191 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:19 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 1..1941 251..2191 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:04 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 1..1941 251..2191 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:12 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 1..1941 251..2191 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:38 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 62..2692 1..2631 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:08 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 62..2692 1..2631 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:19 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 16..2646 1..2631 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:10 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 62..2692 1..2631 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:12 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 16..2646 1..2631 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:49:12 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7971637..7971988 1..352 100   Minus
2R 7971244..7971529 353..638 100 <- Minus
2R 7970774..7971182 639..1047 100 <- Minus
2R 7970532..7970713 1048..1229 100 <- Minus
2R 7970235..7970474 1230..1469 100 <- Minus
2R 7969869..7970176 1470..1777 100 <- Minus
2R 7969574..7969769 1778..1973 100 <- Minus
2R 7968819..7969476 1974..2631 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:19 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3859142..3859493 1..352 100   Minus
arm_2R 3858749..3859034 353..638 100 <- Minus
arm_2R 3858279..3858687 639..1047 100 <- Minus
arm_2R 3858037..3858218 1048..1229 100 <- Minus
arm_2R 3857740..3857979 1230..1469 100 <- Minus
arm_2R 3857374..3857681 1470..1777 100 <- Minus
arm_2R 3857079..3857274 1778..1973 100 <- Minus
arm_2R 3856324..3856981 1974..2631 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:32 Download gff for FI05228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7972836..7973187 1..352 100   Minus
2R 7972443..7972728 353..638 100 <- Minus
2R 7971973..7972381 639..1047 100 <- Minus
2R 7971731..7971912 1048..1229 100 <- Minus
2R 7971434..7971673 1230..1469 100 <- Minus
2R 7971068..7971375 1470..1777 100 <- Minus
2R 7970773..7970968 1778..1973 100 <- Minus
2R 7970018..7970675 1974..2631 100 <- Minus

FI05228.pep Sequence

Translation from 250 to 2190

> FI05228.pep
MAVFASRYERKLPIDDTQALSCEITAVQEVAGHTEYLLRVWRGASNKNYW
TVLRRYNDFDRLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQALQEYI
NAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGG
SMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGS
GHSIDAGTLDPGSEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQHPHIEP
VLLAAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFLSKYGNPKGRTAL
SMKQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIVDDCVKLLDIENFL
LGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVRQIT
ECPEALKCLLESILSKEACKAGLPTLEQLLGHRFFLQYASTESAGAAANA
EKPYFKLSLNAKELLKQAAIKSENRLRDEQKSVKNQKRIVRVQELMSSEE
EKRKSKQKAKLEHKQSKLKQQSSIQTNNGRLSLVAATAAAASSSTTVVGE
LCGTDSFNRSDSTPEEPTTLAGIKSPPLTPGPHLGSIYQQELPSTTGAPV
ERQSSTPNMLSEDAEGGDGDEPTRSALLESICKFNRGSLRKVRSND*

FI05228.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11224-PA 641 GF11224-PA 1..641 1..646 2913 87.4 Plus
Dana\GF14016-PA 511 GF14016-PA 231..387 236..391 246 38.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10690-PA 645 GG10690-PA 1..645 1..646 3296 98.3 Plus
Dere\GG23520-PA 644 GG23520-PA 360..516 236..391 247 38.7 Plus
Dere\GG21026-PA 406 GG21026-PA 214..339 13..130 168 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21280-PA 630 GH21280-PA 1..630 1..646 2726 79.6 Plus
Dgri\GH10073-PA 656 GH10073-PA 368..528 229..388 248 38 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-PB 646 CG8726-PB 1..646 1..646 3340 100 Plus
CG8726-PA 563 CG8726-PA 1..563 84..646 2906 100 Plus
CG8726-PC 440 CG8726-PC 1..426 84..509 2212 100 Plus
Slob-PG 459 CG43756-PG 175..433 236..482 240 30.7 Plus
Slob-PA 515 CG43756-PA 231..489 236..482 240 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19106-PA 630 GI19106-PA 1..630 1..646 2716 81.8 Plus
Dmoj\GI16518-PA 511 GI16518-PA 231..384 236..388 246 35.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10606-PA 660 GL10606-PA 1..660 1..646 2831 82.8 Plus
Dper\GL18055-PA 108 GL18055-PA 1..108 237..342 151 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21283-PA 662 GA21283-PA 1..662 1..646 2807 82.1 Plus
Dpse\GA19853-PA 512 GA19853-PA 225..388 229..391 247 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20738-PA 563 GM20738-PA 1..563 84..646 2987 98.6 Plus
Dsec\GM20736-PA 57 GM20736-PA 1..50 1..50 270 96 Plus
Dsec\GM13478-PA 515 GM13478-PA 231..387 236..391 247 38.7 Plus
Dsec\GM19956-PA 407 GM19956-PA 215..340 13..130 168 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10203-PA 646 GD10203-PA 1..646 1..646 3446 98.8 Plus
Dsim\GD22483-PA 638 GD22483-PA 354..510 236..391 247 38.7 Plus
Dsim\GD25447-PA 407 GD25447-PA 215..340 13..130 168 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22235-PA 629 GJ22235-PA 1..629 1..646 2745 80.4 Plus
Dvir\GJ16229-PA 640 GJ16229-PA 360..513 236..388 246 37.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10635-PA 660 GK10635-PA 1..660 1..646 2742 79.3 Plus
Dwil\GK23956-PA 511 GK23956-PA 231..387 236..391 247 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23432-PA 642 GE23432-PA 1..642 1..646 3255 96.7 Plus
Dyak\GE18346-PA 639 GE18346-PA 355..511 236..391 248 38.7 Plus
Dyak\GE13969-PA 408 GE13969-PA 232..341 26..130 162 36.9 Plus

FI05228.hyp Sequence

Translation from 250 to 2190

> FI05228.hyp
MAVFASRYERKLPIDDTQALSCEITAVQEVAGHTEYLLRVWRGASNKNYW
TVLRRYNDFDRLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQALQEYI
NAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGG
SMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGS
GHSIDAGTLDPGSEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQHPHIEP
VLLAAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFLSKYGNPKGRTAL
SMKQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIVDDCVKLLDIENFL
LGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVRQIT
ECPEALKCLLESILSKEACKAGLPTLEQLLGHRFFLQYASTESAGAAANA
EKPYFKLSLNAKELLKQAAIKSENRLRDEQKSVKNQKRIVRVQELMSSEE
EKRKSKQKAKLEHKQSKLKQQSSIQTNNGRLSLVAATAAAASSSTTVVGE
LCGTDSFNRSDSTPEEPTTLAGIKSPPLTPGPHLGSIYQQELPSTTGAPV
ERQSSTPNMLSEDAEGGDGDEPTRSALLESICKFNRGSLRKVRSND*

FI05228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-PB 646 CG8726-PB 1..646 1..646 3340 100 Plus
CG8726-PA 563 CG8726-PA 1..563 84..646 2906 100 Plus
CG8726-PC 440 CG8726-PC 1..426 84..509 2212 100 Plus
Slob-PG 459 CG43756-PG 175..433 236..482 240 30.7 Plus
Slob-PA 515 CG43756-PA 231..489 236..482 240 30.7 Plus