Clone FI05231 Report

Search the DGRC for FI05231

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:31
Vector:pOT2
Associated Gene/TranscriptGtp-bp-RA
Protein status:FI05231.pep: gold
Sequenced Size:2064

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Gtp-bp 2008-12-18 5.12 accounting

Clone Sequence Records

FI05231.complete Sequence

2064 bp assembled on 2008-08-28

GenBank Submission: BT044198.1

> FI05231.complete
TGACGTGGAACGTGTGGCAACTTTTGATTTGATGCAAATGCAATGCGAGT
AGAGTGCGTTGTTGTTGAAAGTGACGACGGATCGGAAGCGTAGCTAAAAT
GTTGGACTTTGTGGTGATATTCACCAAGGGCGGAGTGGTGCTGTGGCACT
CGAACGCGTCCGGTAACAGTTTCGCCTCCTGCATCAACAGCCTGATACGT
GGCGTCATTCTGGAGGAGCGCAACACAGAGGCCAAGTACTACGAGGAGGA
CCACCTGGCCGTGCAGTTTAAGCTGGACAACGAACTGGACCTGGTCTATG
CGGCCATTTTCCAGAAGGTGATCAAACTGAACTACCTAGATGGATTCCTG
GCCGACATGCAGGCGGCCTTCAAGGAAAAGTACGGCGACATACGTCTGGG
CGATGACTACGACTTCGATCGCGAATATCGACGCGTGCTCAGCGCCGCGG
AGGAGGCGTCCGCCAAGCAAGTGAAAGCACCTAAAACCATGCGCTCCTAC
AACGAGTCACAGAAATCGAAAAAGACCGTCGCCTCGATGATACAGGACGA
CAAGAAGCCGGTGGAGAAGCGGGTGAACATCCAGGAGGCCCCGCCACCAT
CCAAATCACAGCCGTCGTCGCCACCGACGGGCTCCCCAATGGACAAGATC
ATCATGGAGAAACGGCGCAAGCTGCGCGAAAAGCTCACGCCCACCAAGAA
GACCTCGCCCAGTGATTCCAAGTCCAGCAAGCCCGAGAAGGCCGGCAAGA
AGCCACGCGTCTGGGATCTGGGCGGTAATTCCAAGGATGCCGCTCTGCTC
GATCGCTCCAGGGATTCGCCCGATGATGTGCAGTACCAGAACATCAACAG
CGAGCTGGTGGGCACAATGCAGGGCGTCATCCGCGACTTGGATGTGGAGA
GCGAGGACGAGGCTGACAACGAGGATGCATCCTCTGAGGGGGAGGCCGAG
GAGCAGGTGCAGTCAAAGAAGGGCAAGCGCGGTGGCCTGCTATCCTACTT
CAAGGGCATTGTAGGCGCCAAGACCATGTCGCTGGCAGATTTGCAGCCGG
CGCTGGAGAAGATGCGCGACCATCTGATATCGAAGAACGTGGCCTCTGAG
ATAGCAGCTAAGCTGTGCGACTCGGTGGCCGCCAGTTTGGATGGCAAGCA
AATGGGCACATTCGACAGCATCGCCAGCCAGGTGAAGGAGGCGCTCACGG
AATCGCTGGTGAGGATACTATCGCCCAAACGGCGCATCGACATCATACGC
GATGCCCTCGAATCGAAGCGCAACGGCCGCCCGTACACGATAATCTTCTG
CGGTGTCAATGGTGTCGGCAAGTCCACCAATTTGGCCAAGATCTGCTTTT
GGCTGATCGAGAACGATTTCAACGTTCTGATCGCCGCCTGCGATACGTTC
CGAGCCGGTGCCGTCGAGCAGTTGCGCACACACACACGCCATCTGAACGC
ACTGCATCCGGCGGCCAAGCACGATGGACGCAACATGGTGCAGTTGTACG
AGAAGGGTTACGGCAAGGATGCCGCCGGCATTGCCATGGAGGCCATCAAG
TTTGCCCACGATACGCGAGTGGATGTGGTGCTTGTGGACACCGCCGGACG
CATGCAGGATAACGAGCCGCTGATGCGTTCCCTGTCCAAGCTAATCAAAG
TGAACAATCCGGATCTGGTGCTATTCGTGGGCGAGGCACTGGTGGGCAAC
GAAGCCGTCGACCAGCTGGTCAAGTTCAATCAGTCGCTGGCCGACTACTC
ATCCAACGAGAACCCGCACATCATCGACGGCATAGTGTTGACCAAGTTCG
ATACCATCGATGACAAGGTGGGCGCCGCCATCTCCATGACCTACATAACC
GGCCAGCCAATTGTGTTCGTGGGCACGGGTCAGACGTATGCCGACCTAAA
GGCCATCAATGTGAACGCCGTGGTCAATTCCCTGATGAAGTAAGCCAGCC
GTCGATCCGGCTATCCTTCCAATGCTCCTTGTTTGCATCCACTCTTTTCA
CCGAATCAAATATATGGCTTTTGTCTAGTTTGTTGTTGCGTAAAAAAAAA
AAAAAAAAAAAAAA

FI05231.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-RA 2214 Gtp-bp-RA 119..2162 1..2044 10220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11018124..11019312 2041..853 5945 100 Minus
chrX 22417052 chrX 11019398..11020042 854..210 3210 99.8 Minus
chrX 22417052 chrX 11020104..11020319 216..1 1080 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-RA 1845 CG2522-PA 1..1845 99..1943 9225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-RA 2056 CG2522-RA 16..2056 1..2041 10205 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-PA 614 CG2522-PA 1..614 99..1940 2782 100 Plus
Srp54k-PA 508 CG4659-PA 28..295 1041..1937 221 22.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11126874..11128065 2044..853 5960 100 Minus
X 23542271 X 11128151..11128795 854..210 3210 99.8 Minus
X 23542271 X 11128857..11129072 216..1 1080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11134972..11136163 2044..853 5960 100 Minus
X 23527363 X 11136249..11136893 854..210 3210 99.8 Minus
X 23527363 X 11136955..11137170 216..1 1080 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:03:37 has no hits.

FI05231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:36:51 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11020105..11020319 1..215 100   Minus
chrX 11019398..11020036 216..854 100 <- Minus
chrX 11018124..11019310 855..2041 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:09 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 1..1845 99..1943 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:07:59 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 1..1845 99..1943 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:05 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 1..1845 99..1943 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:36:51 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 1..1845 99..1943 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:40 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 32..2072 1..2041 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:09 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 32..2072 1..2041 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:07:59 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 16..2056 1..2041 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:13 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 32..2072 1..2041 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:36:51 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 16..2056 1..2041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:36:51 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
X 11128858..11129072 1..215 100   Minus
X 11128151..11128789 216..854 100 <- Minus
X 11126877..11128063 855..2041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:07:59 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11022891..11023105 1..215 100   Minus
arm_X 11022184..11022822 216..854 100 <- Minus
arm_X 11020910..11022096 855..2041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:33 Download gff for FI05231.complete
Subject Subject Range Query Range Percent Splice Strand
X 11136956..11137170 1..215 100   Minus
X 11136249..11136887 216..854 100 <- Minus
X 11134975..11136161 855..2041 100 <- Minus

FI05231.pep Sequence

Translation from 98 to 1942

> FI05231.pep
MLDFVVIFTKGGVVLWHSNASGNSFASCINSLIRGVILEERNTEAKYYEE
DHLAVQFKLDNELDLVYAAIFQKVIKLNYLDGFLADMQAAFKEKYGDIRL
GDDYDFDREYRRVLSAAEEASAKQVKAPKTMRSYNESQKSKKTVASMIQD
DKKPVEKRVNIQEAPPPSKSQPSSPPTGSPMDKIIMEKRRKLREKLTPTK
KTSPSDSKSSKPEKAGKKPRVWDLGGNSKDAALLDRSRDSPDDVQYQNIN
SELVGTMQGVIRDLDVESEDEADNEDASSEGEAEEQVQSKKGKRGGLLSY
FKGIVGAKTMSLADLQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGK
QMGTFDSIASQVKEALTESLVRILSPKRRIDIIRDALESKRNGRPYTIIF
CGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAGAVEQLRTHTRHLN
ALHPAAKHDGRNMVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAG
RMQDNEPLMRSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADY
SSNENPHIIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADL
KAINVNAVVNSLMK*

FI05231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20395-PA 628 GF20395-PA 1..628 1..614 2755 85 Plus
Dana\GF23972-PA 508 GF23972-PA 28..295 315..613 216 23.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18880-PA 615 GG18880-PA 1..615 1..614 2916 94.6 Plus
Dere\GG15264-PA 508 GG15264-PA 28..295 315..613 207 22.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24806-PA 628 GH24806-PA 1..628 1..614 2565 81.3 Plus
Dgri\GH16182-PA 508 GH16182-PA 28..295 315..613 206 22.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-PA 614 CG2522-PA 1..614 1..614 3110 100 Plus
Srp54k-PA 508 CG4659-PA 28..295 315..613 221 22.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21534-PA 636 GI21534-PA 1..636 1..614 2719 82.1 Plus
Dmoj\GI13333-PA 508 GI13333-PA 28..295 315..613 214 23.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27063-PA 610 GL27063-PA 1..610 1..614 2664 82.6 Plus
Dper\GL22620-PA 508 GL22620-PA 28..295 315..613 215 23.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15385-PA 621 GA15385-PA 1..621 1..614 2764 84.7 Plus
Dpse\GA18336-PA 508 GA18336-PA 28..295 315..613 215 23.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11265-PA 2214 GM11265-PA 1..408 1..408 1966 94.6 Plus
Dsec\GM14699-PA 508 GM14699-PA 28..295 315..613 203 22.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13881-PA 508 GD13881-PA 28..295 315..613 203 22.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16008-PA 633 GJ16008-PA 1..633 1..614 2707 81.9 Plus
Dvir\GJ13160-PA 508 GJ13160-PA 28..295 315..613 207 22.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16226-PA 624 GK16226-PA 1..624 1..614 2651 82.3 Plus
Dwil\GK20323-PA 508 GK20323-PA 28..295 315..613 210 22.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Gtp-bp-PA 617 GE17321-PA 1..617 1..614 3007 94.8 Plus
Dyak\GE21487-PA 508 GE21487-PA 28..295 315..613 207 22.7 Plus

FI05231.hyp Sequence

Translation from 98 to 1942

> FI05231.hyp
MLDFVVIFTKGGVVLWHSNASGNSFASCINSLIRGVILEERNTEAKYYEE
DHLAVQFKLDNELDLVYAAIFQKVIKLNYLDGFLADMQAAFKEKYGDIRL
GDDYDFDREYRRVLSAAEEASAKQVKAPKTMRSYNESQKSKKTVASMIQD
DKKPVEKRVNIQEAPPPSKSQPSSPPTGSPMDKIIMEKRRKLREKLTPTK
KTSPSDSKSSKPEKAGKKPRVWDLGGNSKDAALLDRSRDSPDDVQYQNIN
SELVGTMQGVIRDLDVESEDEADNEDASSEGEAEEQVQSKKGKRGGLLSY
FKGIVGAKTMSLADLQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGK
QMGTFDSIASQVKEALTESLVRILSPKRRIDIIRDALESKRNGRPYTIIF
CGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAGAVEQLRTHTRHLN
ALHPAAKHDGRNMVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAG
RMQDNEPLMRSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADY
SSNENPHIIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADL
KAINVNAVVNSLMK*

FI05231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-PA 614 CG2522-PA 1..614 1..614 3110 100 Plus
Srp54k-PA 508 CG4659-PA 28..295 315..613 221 22.7 Plus