Clone FI05242 Report

Search the DGRC for FI05242

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:42
Vector:pOT2
Associated Gene/TranscriptTbce-RB
Protein status:FI05242.pep: gold
Sequenced Size:2068

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7861 2008-12-18 5.12 accounting

Clone Sequence Records

FI05242.complete Sequence

2068 bp assembled on 2008-08-28

GenBank Submission: BT044200.1

> FI05242.complete
CTAAACACTAAATATAAATAATAGTTTGTGACTCAGAATTTAGGCTTCAG
GAGCTACGCAAAGCTTTATTTCCTCTTCATCAAAGCTGTAATGTTGATGT
AAATCCAGGAGAAATCGTTTACAGCTATATCTGAACACATTCTGGGAGCA
GCTGCGAATAAGCAGACAAAGGTGTGAACGAGTGTGTAACAGCCGTGTAT
ACTTGTGTGGGCGCCGAGGAAACTACAAACAAGAGCCAAAGCGATGGTGG
GAATTATCGATGAGGTGCAGCTTTTTTATCCCCTAGGAACCCGCATCAAA
ATTGGGGACAACTACGGCACAGTGCGTTATGTGGGAGAGGTGAGCGGCCA
TATGGGTAGCTGGCTGGGAATAGAATGGGACGACGGACTGCGTGGCAAAC
ACAACGGCATCGTGGACGGCAAGCGCTACTTTCAGACGCAGACACCCACG
GGAGGCAGCTTCATCCGACCGGGAAAGGTAGGGCCTTGTGCCACCCTGGA
GGACGCTGCTCGGGAGCGGTACCTAAACTACGACTCGAGCAACGTCGACG
AGTCTCTTATCCGGGAAGCTCAGGCCAGCCTGCAGGCGTCGCTTTTTGAA
GTCGTGGGCATGGACAAGATCGCTCGCAAGCAAAGCAAGTTCGAGCAACT
GGAGGAGGTGAGTGTAGACCAGACGCCGGTAAACGCTGCCGGTTACCTGA
AGGAGTTGACACACCTCACAACGTTGAACGTAAGCCATACCTTAATCTGG
AATTGGGAGATCGTGGCCAGTATAGCGCAACAGCTACCCTCCTTAACCAA
CCTGAACCTGAGCTCCAACCGATTGGTCCTGCCCACGTCATCCCAAATCA
CTGAGCTTGAGCCCTCATTTCGGCAGCTCAAACGCATCAACCTTCGCAGT
TGTGGCTTTTCCGACTGGAAGGATGTAATGCACACAGCGCTTCTCTGGCC
AAATATTTTGTCACTGGGCTTACAGGAGAATTCACTCGGCCAGCTAGCAG
AAGTCGATCGAACAAAGATATTTAAGCAGCTACATGAACTCGACTTACAC
CGCACGAACATTATGGATTTTGACCAGGTGACAAAGTTGGGCAACCTCAC
GACTTTGCGCTTACTGAATATCATGGAGAATGGTATCGAGGAGATAAAAC
TTCCCGACTGTGATTCACAAGAAAAGCTTAATATTTTTGTCTCGCTGGAG
CAGCTGAACCTGCTTCACAATCCCATTTGGAATGAGGCTGATGCGTTTAA
CGAGCTGGACAAGCTGCCACAGCTGAAACGCCTGAGTAAGACTCCGCACT
TAAAGTCAAACTTTGATGAAATGTTCTCCAAAGCTGTAGCTAGCATAGCC
AGCCTGCAGTTCATTAATAAAGCCGAGGTGACAGCGGAACAGAGACGTGG
AGCCGAGTACGATATTTGGAAAAAGTATGCTCTAGATTGGATGCAGGCGA
CGCAAGGGGGGACAGATTCCTTACGGGAGTTTTGCCGAAGACATCGCACC
TACCCCCTGCTGGTTAAAAAGTACGGTTCCCCGGCAGACTTTGTACCGCG
TAGTCAAGCGAAGCAGTCGAATTTGATTAATGTTTCCATAAGACATCAGC
TGACGGGCGAAACCTGGGAGAAGAAAGTCCCGCGAATGATTACTGTGCAG
ACGCTGCAGGGATTGGTTATGAAGCGATTCCGGTTAAGCGGTGACGTCCC
GCAGCTTTGCTACGTTGATGCGTTGCATCCGGATCTTGTGGTACCATTGG
ATAACAATGCTAAAACACTGGACTTTTATTCTGTACAGGAGCATGATACA
GTTTTGGTTCAATAGCGGCCAGTATAATAGCACGGACTTTGCACCATTCT
CCGTATTTAGATGTATTACAGTTTTAGACAAATGAAAATCAAAAATTCTT
GTTCGATTTTACTTCTGTCTCCCTCTGTTTTAAAGTGCAAATGTTATGTT
AAGGTACTAATAAGTTGAACATTTCACTAAGCAATTCCACTCAGATATTT
ATACTGTTTTGCTTTTCAAAAAAGAAAACACGTTATTTAACCAGATAATT
AAAAAAAAAAAAAAAAAA

FI05242.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7861-RB 2223 CG7861-RB 129..2184 1..2056 10250 99.9 Plus
CG7861.a 2212 CG7861.a 114..2150 20..2056 10155 99.9 Plus
CG7861-RA 2137 CG7861-RA 31..1267 1..1237 6155 99.8 Plus
CG7861-RA 2137 CG7861-RA 1322..2137 1235..2050 4080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1931583..1932113 1520..2050 2655 100 Plus
chr2R 21145070 chr2R 1930237..1930711 338..812 2345 99.6 Plus
chr2R 21145070 chr2R 1930759..1931185 811..1237 2120 99.8 Plus
chr2R 21145070 chr2R 1929831..1930175 1..345 1725 100 Plus
chr2R 21145070 chr2R 1931243..1931527 1235..1519 1425 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-RC 1572 CG7861-PC 1..1572 244..1815 7830 99.9 Plus
Tbce-RB 1572 CG7861-PB 1..1572 244..1815 7830 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-RB 2080 CG7861-RB 31..2080 1..2050 10220 99.9 Plus
Tbce-RC 2144 CG7861-RC 114..2144 20..2050 10125 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-PC 523 CG7861-PC 1..523 244..1812 2624 100 Plus
Tbce-PB 523 CG7861-PB 1..523 244..1812 2624 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6044434..6044970 1520..2056 2685 100 Plus
2R 25286936 2R 6043091..6043565 338..812 2345 99.6 Plus
2R 25286936 2R 6043613..6044039 811..1237 2135 100 Plus
2R 25286936 2R 6042685..6043029 1..345 1725 100 Plus
2R 25286936 2R 6044094..6044378 1235..1519 1425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6045633..6046169 1520..2056 2685 100 Plus
2R 25260384 2R 6044290..6044764 338..812 2345 99.5 Plus
2R 25260384 2R 6044812..6045238 811..1237 2135 100 Plus
2R 25260384 2R 6043884..6044228 1..345 1725 100 Plus
2R 25260384 2R 6045293..6045577 1235..1519 1425 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:29:35 has no hits.

FI05242.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:49:16 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1931583..1932113 1520..2050 100   Plus
chr2R 1931245..1931527 1237..1519 100 -> Plus
chr2R 1930761..1931184 813..1236 99 -> Plus
chr2R 1930239..1930711 340..812 99 -> Plus
chr2R 1929831..1930169 1..339 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:51 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
CG7861-RB 1..1572 244..1815 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:10 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 1..1572 244..1815 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:23 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 1..1572 244..1815 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:05 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
CG7861-RB 1..1572 244..1815 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:16 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
Tbce-RB 1..1572 244..1815 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:42 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
CG7861-RB 31..2080 1..2050 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:10 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 31..2080 1..2050 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:23 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 31..2080 1..2050 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:16 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
CG7861-RB 31..2080 1..2050 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:16 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
Tbce-RB 31..2080 1..2050 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:49:16 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6044434..6044964 1520..2050 100   Plus
2R 6044096..6044378 1237..1519 100 -> Plus
2R 6043615..6044038 813..1236 100 -> Plus
2R 6043093..6043565 340..812 99 -> Plus
2R 6042685..6043023 1..339 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:23 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1931939..1932469 1520..2050 100   Plus
arm_2R 1931601..1931883 1237..1519 100 -> Plus
arm_2R 1931120..1931543 813..1236 100 -> Plus
arm_2R 1930598..1931070 340..812 99 -> Plus
arm_2R 1930190..1930528 1..339 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:35 Download gff for FI05242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6045633..6046163 1520..2050 100   Plus
2R 6045295..6045577 1237..1519 100 -> Plus
2R 6044814..6045237 813..1236 100 -> Plus
2R 6044292..6044764 340..812 99 -> Plus
2R 6043884..6044222 1..339 100 -> Plus

FI05242.pep Sequence

Translation from 243 to 1814

> FI05242.pep
MVGIIDEVQLFYPLGTRIKIGDNYGTVRYVGEVSGHMGSWLGIEWDDGLR
GKHNGIVDGKRYFQTQTPTGGSFIRPGKVGPCATLEDAARERYLNYDSSN
VDESLIREAQASLQASLFEVVGMDKIARKQSKFEQLEEVSVDQTPVNAAG
YLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSS
QITELEPSFRQLKRINLRSCGFSDWKDVMHTALLWPNILSLGLQENSLGQ
LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEE
IKLPDCDSQEKLNIFVSLEQLNLLHNPIWNEADAFNELDKLPQLKRLSKT
PHLKSNFDEMFSKAVASIASLQFINKAEVTAEQRRGAEYDIWKKYALDWM
QATQGGTDSLREFCRRHRTYPLLVKKYGSPADFVPRSQAKQSNLINVSIR
HQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVDALHPDLVV
PLDNNAKTLDFYSVQEHDTVLVQ*

FI05242.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11041-PA 523 GF11041-PA 1..523 1..523 2437 86 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23192-PA 523 GG23192-PA 1..523 1..523 2720 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20927-PA 523 GH20927-PA 1..523 1..523 2336 81.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-PC 523 CG7861-PC 1..523 1..523 2715 100 Plus
Tbce-PB 523 CG7861-PB 1..523 1..523 2715 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18365-PA 524 GI18365-PA 1..524 1..523 2245 78.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16698-PA 523 GL16698-PA 1..523 1..523 2368 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20640-PA 523 GA20640-PA 1..523 1..523 2381 83.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16532-PA 523 GM16532-PA 1..523 1..523 2778 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10392-PA 523 GD10392-PA 1..523 1..523 2790 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21436-PA 523 GJ21436-PA 1..523 1..523 2324 80.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21325-PA 523 GK21325-PA 1..523 1..523 2429 84.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20681-PA 523 GE20681-PA 1..523 1..523 2686 95.2 Plus

FI05242.hyp Sequence

Translation from 243 to 1814

> FI05242.hyp
MVGIIDEVQLFYPLGTRIKIGDNYGTVRYVGEVSGHMGSWLGIEWDDGLR
GKHNGIVDGKRYFQTQTPTGGSFIRPGKVGPCATLEDAARERYLNYDSSN
VDESLIREAQASLQASLFEVVGMDKIARKQSKFEQLEEVSVDQTPVNAAG
YLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSS
QITELEPSFRQLKRINLRSCGFSDWKDVMHTALLWPNILSLGLQENSLGQ
LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEE
IKLPDCDSQEKLNIFVSLEQLNLLHNPIWNEADAFNELDKLPQLKRLSKT
PHLKSNFDEMFSKAVASIASLQFINKAEVTAEQRRGAEYDIWKKYALDWM
QATQGGTDSLREFCRRHRTYPLLVKKYGSPADFVPRSQAKQSNLINVSIR
HQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVDALHPDLVV
PLDNNAKTLDFYSVQEHDTVLVQ*

FI05242.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-PC 523 CG7861-PC 1..523 1..523 2715 100 Plus
Tbce-PB 523 CG7861-PB 1..523 1..523 2715 100 Plus