Clone FI05248 Report

Search the DGRC for FI05248

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:48
Vector:pOT2
Associated Gene/Transcriptdefl-RA
Protein status:FI05248.pep: gold
Sequenced Size:3161

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
defl 2008-08-15 Release 5.9 accounting
defl 2008-12-18 5.12 accounting

Clone Sequence Records

FI05248.complete Sequence

3161 bp assembled on 2008-07-17

GenBank Submission: BT044201.1

> FI05248.complete
TGCGATAAATGTGAGTGAGGAAACCTGTAACCATGTCTCACCTGACCGGC
ACCCGCGTGAGCACCTTCAACGAGAGCTTCCTTAACGAAAATGAGCACGA
CTCGAATGCGGTGCTCATGGAACTGGACAAGGGACTGCGGAGCACCAAGC
AGGGAATCCAGTGCGAGGCGGTCGTCCGCTTTCCGCGCCTCTTCGAGAAG
TATCCGTTTCCCATTCTCATCAACTCGTCGTTCATTAAGCTGGCCGATTA
CTTTGTCAGCGGATCGAATCTGCTGCGCTTCTGGGTGCTCCGTGTTTGCC
AGCAGAGCGAGAATCATCTGGACAAGATCCTCAACATTGACAGCTTTGTG
CGCTGTATCTTTGTGGTGATGCACTCCAACGATCCGGTGGCGCGTGCTCT
CCTCCTGCGCACCTTGGGCGCCGTTTCCCGTGTGATTCCCGAGAAGCAAC
AGGTTCATCATGCCATTCGACGTGCTCTGGATAGCCACGATACCGTCGAG
GTGGAGGCTGCCATCTATGCCAGCAGCTGCTTTGCCGCCCAGTCAAGTTC
CTTTGCCATCAGCATGTGCGCCAAGATTTCGGACATGATCGAATCGCTTC
AGGTGCCGGTGCCAATGAAGCTGCTCCTGATTCCCGTGTTGCGACACATG
CATCACGAGGCTACCACAGCGTCACTGGTTAGCAGACTGTGCATGGATCT
GCTGCCCAAATATCCAGCCCAGAGCTTTGTGGTGGCCATCATAGACACGC
TCACTCAATTGTCATCACGAACGCTGGTGGGAGTGCCCGGTCAGCTGGAT
GTTCTGCTGGATTTCATGCAGGACTTAAGGACACCAGTACGCATACAGGT
GCTGCGATCTTTCAACGAGTTGGCCGGACGTCAGAGCGTTCATGCCTGGC
CCAAGCCAGCCATCAAAGCGCTCATTGATCGTTTTGAATTGTGTACCAAT
TCCAAGGAGCAGTTCCTCTTCCTCTCAATCCTGCTGAAGTTAAGCGAGTG
CCCGCTTACTTGCCAGCAGCTGCTTCGCGAGCATCGCGTAGCCCTGCTCC
GTTTGTGCATCCAGTGCATTAGCAAGCTGGACGACTACACCACCGCCACT
CAGGCCATGGCAGTTTTGTCGGTTCTAGTAGCATTTGGTTTAAAAAAAAA
GGGCAGCGGCGAGCAGGTGGACGATATTCTTCATATGGTCAACCTGCACA
TGGAAGGATTGCTCCTTTGCACGGCCAAGCGGTCGGAGTGCACCCGCGAT
CTCCGTAGGGTGCTGACATACGGTATAAGGATCACTAAAGCCAACGCTGA
ATTTGGAACATCCTTCATTGGGATCGTGACCAATAGCCTGGGAGATAAGG
GTGCCTATCCGCCAGCCAATGCGGAACTTATGTGCGAGGCACTGGCGGGT
CTGTGTGAGCACTTTCAGCTGCGTAAGTACGCCTTTTCCACCGCAGAAGA
TTTGATAGTAGACGAAAACGCGATGGACACCGATGAGTTGCCCCCGCCCA
AGATAAATCCCATGCTAGCTCGTTTGCCGCTCATTCTGCACAAGCTGAAC
ACCATTATCGACCAGGAGAATTGCGATCAACAGTTGCGCAGCGTGGAGAT
CCTGAGTTCTCTGGTTCTACAAACCACCATGGGCTGTTACCTGCCGCAAA
AGGTTGTTCAGTGCTTTGAGAAATGCCTCGGTAGGCTTAACTGCTGGACG
CTGTATAGGATTGCACGCACTGCTAGTCGCTATGGTCACCACTATGTGGC
TGCTCACATTTACACCAAGGTCTCCCAGATTGTGATCAGCGATCATATGC
ACTATTTCCTGGTGGCACTGTCGCAGATCTCGCAGGCGGAGTGCATTCTT
AACTATGGCTTGGAATACGCCTACATGCGGGACAATTATGCACCAAAGGT
GGCACCGGAACCTCTAATTCCGCTGATGAAGCGCTTGGAAATGGCTAGTA
ATCTCTATCAGCAAGCGCTGGCCAGCCTGCGAGCTGGCTCCTCGCCCCAG
CATCCGTGCACCTTTCAGTTGGAGTATCTGAAGATAAGGGCGCAGTTTCT
GCAGACCCTTCACCTGGCTGTGACCGTAAAGAATGCCCAGGTGATTGTGC
CGCCACCGGCAATAGCTGGAAGTTTGGCCCAGAACTCGCGCGACTATCTG
CAAAAGTTTGGTCATGTCACGAACCAGCTGCGCAAGCTGGTGAAGGCACT
AAAGGCCTGCGAGGAGACTTACGCTAGGCTATACAAATCCTCTTTCGATG
CGGATCACGTGACGCTGGAGTTTCTGGAGGTGGCTGAATTTCAGTGCGCT
CTTTTCGCCCACATCATCGAGTCGATTTGCTACGCCACGCCTCCGGAACC
GCCTGTATTTCTAACCACAGGCGATCACCCGGAGACGCGCTACTTTGCCG
CAAGCTGCCAGCGCATGGAGCAGATGCAAAAAAACCTGCCACAGGAGCCG
GCCAATGCCAAGACCATTAGTAACCGACATTTGGATGTCATCATTGCGCA
GATCGAGATCATAACAAAGACACCGCTCTGCCTGCCGCGTTACTTCTTCC
AGATTCTGCAGTCCACACAGATCAAGCTATCGGTGAGTCCGCAGCCAAGG
AGCGCCACCGAACCCGTGAATGTCCAGTCGGGCAGTAATCTGGTTATCAA
GGTCGAGGGTGTCCTGCAGCACTTTAGCAAGCAGAAGAAACACTTCCGTC
GCGTGGAGTCCGTTCAATTAAGCCTCACCTCACAGCTAATCACGCCGCCA
CCGCGATCCTCGCAAGAGCTGCCCAAGCAGGGCGCCAACGATACTGTGAC
CCTCAATCAGATTGTAAAGCCCCAGCGCGATTTCCTCTCCGGCAGCTTCC
TGTTGCCCATCTCCAATGGCGGGCACTTCCAGGTGACGCTGGAAACATTC
GTGGTGGACGAGAATGGCATTACCTGGTGCACTGGCCCCAAATCCTCGAT
GGTGGTGCGGGTGCTGGAGGATCCTAGCAAGCAGGGCGCTCCAGCGCCGA
GCACTTCCCAGGCAGTGGGACAGACGAGGAGGTTTTAAACATTAAAAACG
GGTTTCTATATGTCTTAAGATTAAATATTTTTAAAAATATAAATATTAGT
TTAGGCATTACATCCAAAGTGGAAATATACGTTTTTCATCAAAAAAAAAA
AAAAAAAAAAA

FI05248.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
defl-RA 3334 defl-RA 194..3334 1..3141 15705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9716922..9718561 1501..3140 8110 99.6 Plus
chr3L 24539361 chr3L 9715364..9716866 1..1502 7285 99.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
defl-RA 3006 CG18176-PA 1..3006 33..3038 15030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
defl-RA 3227 CG18176-RA 88..3227 1..3140 15700 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
defl-PA 1001 CG18176-PA 1..1001 33..3035 5051 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9725067..9726712 1501..3146 8215 99.9 Plus
3L 28110227 3L 9723510..9725011 1..1502 7510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9718167..9719812 1501..3146 8215 99.9 Plus
3L 28103327 3L 9716610..9718111 1..1502 7510 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:13:22 has no hits.

FI05248.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:53 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9716924..9718561 1503..3140 97   Plus
chr3L 9715364..9716866 1..1502 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:55 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 1..3006 33..3038 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:38 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 1..3006 33..3038 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:17 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 1..3006 33..3038 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:54:07 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 1..3006 33..3038 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:53 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 1..3006 33..3038 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:14 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 84..3223 1..3140 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:38 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 84..3223 1..3140 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:17 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 88..3227 1..3140 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:54:07 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 84..3223 1..3140 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:53 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 88..3227 1..3140 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:53 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9725069..9726706 1503..3140 100   Plus
3L 9723510..9725011 1..1502 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:17 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9718169..9719806 1503..3140 100   Plus
arm_3L 9716610..9718111 1..1502 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:42 Download gff for FI05248.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9718169..9719806 1503..3140 100   Plus
3L 9716610..9718111 1..1502 100 -> Plus

FI05248.pep Sequence

Translation from 32 to 3037

> FI05248.pep
MSHLTGTRVSTFNESFLNENEHDSNAVLMELDKGLRSTKQGIQCEAVVRF
PRLFEKYPFPILINSSFIKLADYFVSGSNLLRFWVLRVCQQSENHLDKIL
NIDSFVRCIFVVMHSNDPVARALLLRTLGAVSRVIPEKQQVHHAIRRALD
SHDTVEVEAAIYASSCFAAQSSSFAISMCAKISDMIESLQVPVPMKLLLI
PVLRHMHHEATTASLVSRLCMDLLPKYPAQSFVVAIIDTLTQLSSRTLVG
VPGQLDVLLDFMQDLRTPVRIQVLRSFNELAGRQSVHAWPKPAIKALIDR
FELCTNSKEQFLFLSILLKLSECPLTCQQLLREHRVALLRLCIQCISKLD
DYTTATQAMAVLSVLVAFGLKKKGSGEQVDDILHMVNLHMEGLLLCTAKR
SECTRDLRRVLTYGIRITKANAEFGTSFIGIVTNSLGDKGAYPPANAELM
CEALAGLCEHFQLRKYAFSTAEDLIVDENAMDTDELPPPKINPMLARLPL
ILHKLNTIIDQENCDQQLRSVEILSSLVLQTTMGCYLPQKVVQCFEKCLG
RLNCWTLYRIARTASRYGHHYVAAHIYTKVSQIVISDHMHYFLVALSQIS
QAECILNYGLEYAYMRDNYAPKVAPEPLIPLMKRLEMASNLYQQALASLR
AGSSPQHPCTFQLEYLKIRAQFLQTLHLAVTVKNAQVIVPPPAIAGSLAQ
NSRDYLQKFGHVTNQLRKLVKALKACEETYARLYKSSFDADHVTLEFLEV
AEFQCALFAHIIESICYATPPEPPVFLTTGDHPETRYFAASCQRMEQMQK
NLPQEPANAKTISNRHLDVIIAQIEIITKTPLCLPRYFFQILQSTQIKLS
VSPQPRSATEPVNVQSGSNLVIKVEGVLQHFSKQKKHFRRVESVQLSLTS
QLITPPPRSSQELPKQGANDTVTLNQIVKPQRDFLSGSFLLPISNGGHFQ
VTLETFVVDENGITWCTGPKSSMVVRVLEDPSKQGAPAPSTSQAVGQTRR
F*

FI05248.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24672-PA 1000 GF24672-PA 1..1000 1..1001 5032 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15407-PA 1001 GG15407-PA 1..1001 1..1001 5267 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15427-PA 998 GH15427-PA 1..998 1..1001 4535 85.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
defl-PA 1001 CG18176-PA 1..1001 1..1001 5136 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13028-PA 998 GI13028-PA 1..998 1..1001 4552 86.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16290-PA 993 GL16290-PA 1..993 1..1001 4518 84.4 Plus
Dper\GL24214-PA 973 GL24214-PA 1..973 1..1001 4389 82.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26540-PA 1000 GA26540-PA 1..1000 1..1001 4551 84.7 Plus
Dpse\GA23433-PA 1000 GA23433-PA 1..1000 1..1001 4538 84.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25181-PA 1001 GM25181-PA 1..1001 1..1001 5308 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14212-PA 1001 GD14212-PA 1..1001 1..1001 5317 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12124-PA 998 GJ12124-PA 1..998 1..1001 4521 85.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10946-PA 999 GK10946-PA 1..999 1..1001 4745 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20873-PA 1001 GE20873-PA 1..1001 1..1001 5298 98.4 Plus

FI05248.hyp Sequence

Translation from 32 to 3037

> FI05248.hyp
MSHLTGTRVSTFNESFLNENEHDSNAVLMELDKGLRSTKQGIQCEAVVRF
PRLFEKYPFPILINSSFIKLADYFVSGSNLLRFWVLRVCQQSENHLDKIL
NIDSFVRCIFVVMHSNDPVARALLLRTLGAVSRVIPEKQQVHHAIRRALD
SHDTVEVEAAIYASSCFAAQSSSFAISMCAKISDMIESLQVPVPMKLLLI
PVLRHMHHEATTASLVSRLCMDLLPKYPAQSFVVAIIDTLTQLSSRTLVG
VPGQLDVLLDFMQDLRTPVRIQVLRSFNELAGRQSVHAWPKPAIKALIDR
FELCTNSKEQFLFLSILLKLSECPLTCQQLLREHRVALLRLCIQCISKLD
DYTTATQAMAVLSVLVAFGLKKKGSGEQVDDILHMVNLHMEGLLLCTAKR
SECTRDLRRVLTYGIRITKANAEFGTSFIGIVTNSLGDKGAYPPANAELM
CEALAGLCEHFQLRKYAFSTAEDLIVDENAMDTDELPPPKINPMLARLPL
ILHKLNTIIDQENCDQQLRSVEILSSLVLQTTMGCYLPQKVVQCFEKCLG
RLNCWTLYRIARTASRYGHHYVAAHIYTKVSQIVISDHMHYFLVALSQIS
QAECILNYGLEYAYMRDNYAPKVAPEPLIPLMKRLEMASNLYQQALASLR
AGSSPQHPCTFQLEYLKIRAQFLQTLHLAVTVKNAQVIVPPPAIAGSLAQ
NSRDYLQKFGHVTNQLRKLVKALKACEETYARLYKSSFDADHVTLEFLEV
AEFQCALFAHIIESICYATPPEPPVFLTTGDHPETRYFAASCQRMEQMQK
NLPQEPANAKTISNRHLDVIIAQIEIITKTPLCLPRYFFQILQSTQIKLS
VSPQPRSATEPVNVQSGSNLVIKVEGVLQHFSKQKKHFRRVESVQLSLTS
QLITPPPRSSQELPKQGANDTVTLNQIVKPQRDFLSGSFLLPISNGGHFQ
VTLETFVVDENGITWCTGPKSSMVVRVLEDPSKQGAPAPSTSQAVGQTRR
F*

FI05248.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
defl-PA 1001 CG18176-PA 1..1001 1..1001 5136 100 Plus