Clone FI05259 Report

Search the DGRC for FI05259

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:59
Vector:pOT2
Associated Gene/Transcriptmbt-RA
Protein status:FI05259.pep: gold
Sequenced Size:3261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mbt 2008-08-15 Release 5.9 accounting
mbt 2008-12-18 5.12 accounting

Clone Sequence Records

FI05259.complete Sequence

3261 bp assembled on 2008-07-17

GenBank Submission: BT044204.1

> FI05259.complete
CTCTATTTCTGGCATCGGCAATTATTTCCCTAGGTTTATTATTTTTTTGT
TAAGCGAATTGCTTGTGCGCTCGTGCTGTCGCCATAATGTGTGCAATGTG
TGCCAGCCAGAGGAGCAAGTGGTGAAGGTGTATCGCTTGTGCGCATCTCG
ATTTGTCCATCCATATCCAATTGAATCCCAGTTTCCCAGTCGCGTCCGCT
GCTATGCGTGTGTGTGTGCGTGCGTGCCCGTGTCCCTGCATGTGTGTGTG
TGAGTGAGATCGGGAAGAAGTTGTGTGCTGTTGTTGTTGTTGTTTCTGTC
GGATTTGCCGTTGCCATCGTTTGTTGTTTGTGCATTTTCCATTGTCGGGC
GACGCAACAAAAAGAAAAAAATTACACATTAAAAATAGAGAGCAAGAGCG
AGAGGGAAGGAGTGGTGTGGAGTGGAAAAGGGCGGTAAAAGGGCAGAAAT
TTGGAGCACGGGAAATCCGAGTCGCTGAAGATGTTCTCGAAGAAGAAAAA
GAAACCGCTGATCTCGATGCCCAGCAATTTTGAGCATCGTGTGCACACGG
GCTTCGACAAGCGGGAGAACAAATATGTTGGCCTGCCCCTCCAATGGGCG
TCCATTGTGGGCAACAATCAGATACTCAAGTCCTCCAACCGCCCGCTGCC
ACTGGTCGATCCCTCGGAGATTACGCCCACCGAGATTCTCGATCTGAAGA
CTATTGTGCGTCCGCATCACAACAACAACAAGGCGGACACCACCTCGCTC
AACAGCAGCAGCACAATGATGATGGGCTCAATGGCGCCGATGAATCCCAT
GGCACCTGGCGCACACCCAATGATGAGCCATGGCCCCGGAATGATGATGC
CACCCGAGACGGGCGGCATAGTCCTGCCGAAGACCTCTCACGTGGCCAGA
TCCAATTCGCTGCGGAGTTCCAGTCCGCCGCGAGTGCGACGGGTAGCCAA
TGTGCCGCCATCGGTGCCGGAGGAGGAGGGACCACCGGCAGCTGGAACAC
CGGGAGTAGGTGGAGCTAGTAGCGGTGGCTTTAAGCCACCCGGTGCCCAT
CCCTCCCTGCTCTATAACAGTCAGCATGCGCACGCGAATGGAGCAACAGG
ACCACTGGCCGTGCGCACGGATCAAACCAACCTGCAGCAGTATCGCAGCA
ATCTGGCCCCGCCATCCGGCGGCTCCATGCCCCAGCAACAGCAGACTTCG
CCCGTGGGTTCGGTGGCCAGTGGCACGCGATCCAATCACTCGCACACGAA
CAATGGCAACAGCGGCGGCAGCTATCCTCCCATGTATCCCACAAGCCATC
AGCAGCAGCAGCAGCAGCAACAGCAGGCCAAACAGGGTGGCGATCAGAAC
CAAAATCCTCTGCATCCGCATGCTCATCCGCATCCGCACCATCACCAACA
TTTGGCCAAGTCGGCGTCCAGGGCATCCAGTTCCAGCGGGGGAGCGAGCA
GTGCTGCCCAGCAGGCGAGCGGCGCCAGTGGAGGAGCGGCGGGTCAGCCA
AAGCAGGACCAACGACTCACCCACGAACAGTTCCGTGCCGCCCTTCAGAT
GGTGGTCTCCGCCGGTGATCCACGCGAGAACCTCGACCACTTTAACAAAA
TAGGCGAGGGCTCCACGGGCACCGTATGCATTGCCACGGACAAATCCACA
GGTCGCCAGGTGGCCGTGAAGAAGATGGATCTGCGCAAACAGCAGCGACG
GGAGCTGCTATTCAACGAGGTCGTCATCATGCGGGACTACCATCATCCCA
ATATCGTGGAGACATACTCCAGCTTTCTGGTCAACGATGAGCTTTGGGTG
GTGATGGAGTACCTCGAGGGCGGCGCCCTCACCGATATTGTCACCCATTC
GCGCATGGACGAGGAGCAGATAGCCACCGTCTGCAAGCAATGCTTGAAGG
CTTTGGCCTATTTGCACTCACAGGGCGTCATTCATCGCGACATCAAGTCG
GACTCGATTCTGCTGGCCGCCGATGGTCGCGTGAAGCTATCGGACTTTGG
ATTCTGCGCCCAGGTGTCACAGGAGCTGCCGAAGCGCAAGAGTCTGGTTG
GCACGCCGTATTGGATGTCGCCGGAGGTCATATCGCGCCTGCCGTACGGC
CCGGAAGTGGATATCTGGTCGCTGGGCATCATGGTCATCGAGATGGTGGA
CGGCGAGCCGCCGTTCTTCAACGAACCGCCGCTGCAGGCGATGCGTCGCA
TCCGTGACATGCAGCCGCCGAACCTGAAGAACGCGCACAAGGTCTCGCCG
CGCCTGCAGTCCTTCCTCGACCGGATGCTGGTGCGGGATCCGGCGCAGCG
TGCCACCGCCGCCGAGCTGCTGGCCCATCCCTTCCTGCGCCAGGCAGGAC
CGCCGTCGCTGCTGGTTCCGCTGATGCGCAATGCGCGACACCATCCGTAG
TTGGATGCCACTGGACAACCCAGACGATCCGGCTGCTCGATGAAAGCAAT
CATTCCCACAGACAACGGATCCCGGCCCGTGGGCATCCATCTATTAAATT
CTAGTATTAACATTCAGTTTGGCAGCTGTACTTAAATCCCCGGAGAATCC
TCGAAACGTTGTAAAGTCATTTAAGCTCCGCACATCCATATCCATATCCA
TGCCCACTAACGTTCCAGAAGAGAACGCAATGTGCCTTTCACAAGCCTCG
AAATCGAAATTGAAATCGCATCCTGCAACCGATACGGATGGAGAAACGAT
ATAGCATTTATCTGCCCGAGAACCACATTTTTATATATATATATATATAT
ACATATATGAGTATTTCAGCATTTTGCTCTCTGTCTCTTGTCAATATTGA
TTTGTGTGCGTGTGTGTTTGATTTTTTTTAACCAGCCCATAAAACATTGT
TCGAATATATACATATATACGCTAAGAGCTAATGTTAAAAATCTATATAT
ATATATATATACACATATATTTTTTATAAAAACAAATCCTAATTCTAAGC
AAAAGCGAAACAACGAAGGTGTGAATCGAAGGGAGACAGAAAACGAAAGA
GAAAGAGATAGCGTTAGGCGGAAGAGCATATACAATTTCGACATAAATAT
TTTTTAAACATTTTACATTTTACATTGGTGTGAAAAGTTTGTACGCTCCA
GACATACACATATGCATATATCTAAACACATTCCCGATTTCGAAAATATT
TTAGAACTTTTAGCTTACATTCTTTGTTCTGTTTTTTTGATTTAACCCGT
GTAATTATTAATTAATGAATAAACTTAAATGCGAAAATGTTCAAAAAAAA
AAAAAAAAAAA

FI05259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-RA 3323 mbt-RA 68..3311 1..3244 16220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16500381..16502032 1..1652 8245 99.9 Plus
chrX 22417052 chrX 16503207..16504529 1920..3242 6585 99.8 Plus
chrX 22417052 chrX 16502099..16502375 1648..1924 1370 99.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-RA 1920 CG18582-PA 1..1920 481..2400 9600 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-RA 3269 CG18582-RA 28..3269 1..3242 16210 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-PA 639 CG18582-PA 340..639 1498..2397 1565 100 Plus
Pak-PJ 704 CG10295-PJ 406..698 1510..2388 826 52.6 Plus
Pak-PE 704 CG10295-PE 406..698 1510..2388 826 52.6 Plus
Pak-PB 704 CG10295-PB 406..698 1510..2388 826 52.6 Plus
Pak-PA 704 CG10295-PA 406..698 1510..2388 826 52.6 Plus
mbt-PA 639 CG18582-PA 16..273 526..1299 655 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16610712..16612363 1..1652 8260 100 Plus
X 23542271 X 16613534..16614858 1920..3244 6625 100 Plus
X 23542271 X 16612430..16612706 1648..1924 1385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16618810..16620461 1..1652 8260 100 Plus
X 23527363 X 16621632..16622956 1920..3244 6625 100 Plus
X 23527363 X 16620528..16620804 1648..1924 1385 100 Plus
Blast to na_te.dros performed 2014-11-27 11:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 424..485 2856..2917 148 71 Plus

FI05259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:21:52 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16503211..16504529 1924..3242 95   Plus
chrX 16502103..16502374 1652..1923 99 -> Plus
chrX 16500709..16502031 329..1651 97 -> Plus
chrX 16500637..16500649 257..269 100 == Plus
chrX 16500381..16500582 1..202 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:02 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..1920 481..2400 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:01 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..1920 481..2400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:01 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..1920 481..2400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:25 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..1920 481..2400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:52 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..1920 481..2400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:17 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..3242 1..3242 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:01 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 9..3250 1..3242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:01 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 28..3269 1..3242 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:25 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 1..3242 1..3242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:52 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 28..3269 1..3242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:21:52 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
X 16613538..16614856 1924..3242 100   Plus
X 16612434..16612705 1652..1923 100 -> Plus
X 16610712..16612362 1..1651 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:01 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16507571..16508889 1924..3242 100   Plus
arm_X 16506467..16506738 1652..1923 100 -> Plus
arm_X 16504745..16506395 1..1651 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:53 Download gff for FI05259.complete
Subject Subject Range Query Range Percent Splice Strand
X 16621636..16622954 1924..3242 100   Plus
X 16620532..16620803 1652..1923 100 -> Plus
X 16618810..16620460 1..1651 100 -> Plus

FI05259.pep Sequence

Translation from 480 to 2399

> FI05259.pep
MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILK
SSNRPLPLVDPSEITPTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGS
MAPMNPMAPGAHPMMSHGPGMMMPPETGGIVLPKTSHVARSNSLRSSSPP
RVRRVANVPPSVPEEEGPPAAGTPGVGGASSGGFKPPGAHPSLLYNSQHA
HANGATGPLAVRTDQTNLQQYRSNLAPPSGGSMPQQQQTSPVGSVASGTR
SNHSHTNNGNSGGSYPPMYPTSHQQQQQQQQQAKQGGDQNQNPLHPHAHP
HPHHHQHLAKSASRASSSSGGASSAAQQASGASGGAAGQPKQDQRLTHEQ
FRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGAL
TDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGR
VKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGI
MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRML
VRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNARHHP*

FI05259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21253-PA 623 GF21253-PA 1..623 1..639 2463 82.4 Plus
Dana\GF18356-PA 718 GF18356-PA 418..713 342..637 877 52 Plus
Dana\GF16514-PA 401 GF16514-PA 104..394 347..636 759 46.2 Plus
Dana\GF13179-PA 654 GF13179-PA 25..294 364..633 529 37.9 Plus
Dana\GF17125-PA 403 GF17125-PA 8..276 363..632 515 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19059-PA 639 GG19059-PA 1..639 1..639 2964 97.8 Plus
Dere\GG19949-PA 405 GG19949-PA 108..398 347..636 758 45.9 Plus
Dere\GG13379-PA 650 GG13379-PA 399..645 392..637 714 53.4 Plus
Dere\GG21950-PA 1240 GG21950-PA 17..284 359..620 529 39.9 Plus
Dere\GG20903-PA 666 GG20903-PA 38..307 364..633 522 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12612-PA 645 GH12612-PA 1..644 1..638 2331 76.6 Plus
Dgri\GH19531-PA 827 GH19531-PA 527..822 342..637 876 51.7 Plus
Dgri\GH18242-PA 401 GH18242-PA 104..394 347..636 763 45.9 Plus
Dgri\GH23090-PA 986 GH23090-PA 18..289 359..624 537 39.3 Plus
Dgri\GH22772-PA 691 GH22772-PA 24..293 364..633 521 37.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-PA 639 CG18582-PA 1..639 1..639 3369 100 Plus
Pak-PJ 704 CG10295-PJ 75..698 3..636 939 36.4 Plus
Pak-PE 704 CG10295-PE 75..698 3..636 939 36.4 Plus
Pak-PB 704 CG10295-PB 75..698 3..636 939 36.4 Plus
Pak-PA 704 CG10295-PA 75..698 3..636 939 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11026-PA 614 GI11026-PA 1..613 1..638 2216 74.3 Plus
Dmoj\GI23008-PA 713 GI23008-PA 413..708 342..637 881 51.7 Plus
Dmoj\GI10198-PA 402 GI10198-PA 105..395 347..636 761 46.6 Plus
Dmoj\GI18916-PA 976 GI18916-PA 17..284 359..620 558 40.7 Plus
Dmoj\GI20569-PA 672 GI20569-PA 23..291 364..632 525 38 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15024-PA 636 GL15024-PA 1..635 1..638 2533 80.3 Plus
Dper\GL21741-PA 547 GL21741-PA 232..542 327..637 881 50.2 Plus
Dper\GL22239-PA 253 GL22239-PA 2..246 393..636 699 49.6 Plus
Dper\GL27268-PA 617 GL27268-PA 8..276 363..632 518 37.3 Plus
Dper\GL10521-PA 661 GL10521-PA 21..289 364..632 515 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\mbt-PA 638 GA15000-PA 1..637 1..638 2558 80.6 Plus
Dpse\Pak1-PB 889 GA10224-PB 574..884 327..637 882 50.2 Plus
Dpse\Pak1-PA 720 GA10224-PA 405..715 327..637 880 50.2 Plus
Dpse\Pak3-PB 572 GA13332-PB 275..565 347..636 764 46.2 Plus
Dpse\GA20098-PC 942 GA20098-PC 17..284 359..620 527 39.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13449-PA 636 GM13449-PA 1..636 1..639 2867 98 Plus
Dsec\GM10890-PA 701 GM10890-PA 401..696 342..637 878 52 Plus
Dsec\GM15431-PA 405 GM15431-PA 108..398 347..636 771 46.2 Plus
Dsec\GM21937-PA 947 GM21937-PA 17..284 359..620 529 39.9 Plus
Dsec\GM19825-PA 668 GM19825-PA 38..307 364..633 525 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17288-PA 404 GD17288-PA 1..404 233..639 1796 97.5 Plus
Dsim\GD19869-PA 701 GD19869-PA 401..696 342..637 877 52 Plus
Dsim\GD20287-PA 405 GD20287-PA 108..398 347..636 771 46.2 Plus
Dsim\GD11434-PA 1165 GD11434-PA 17..284 359..620 530 39.9 Plus
Dsim\GD25317-PA 668 GD25317-PA 38..307 364..633 525 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15625-PA 622 GJ15625-PA 1..621 1..638 2243 77.6 Plus
Dvir\GJ24601-PA 705 GJ24601-PA 405..700 342..637 875 51.7 Plus
Dvir\GJ23486-PA 401 GJ23486-PA 104..394 347..636 772 47.3 Plus
Dvir\GJ19771-PA 1037 GJ19771-PA 17..288 359..624 547 39.7 Plus
Dvir\GJ21419-PA 681 GJ21419-PA 23..291 364..632 523 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25207-PA 639 GK25207-PA 1..638 1..638 2298 74.9 Plus
Dwil\GK14065-PA 401 GK14065-PA 104..394 347..636 752 45.9 Plus
Dwil\GK15703-PA 636 GK15703-PA 17..286 364..633 533 37.9 Plus
Dwil\GK20667-PA 1300 GK20667-PA 17..284 359..620 531 39.9 Plus
Dwil\GK22562-PA 621 GK22562-PA 10..278 363..632 511 37.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17281-PA 637 GE17281-PA 1..637 1..639 2822 95.6 Plus
Dyak\GE10214-PA 704 GE10214-PA 404..699 342..637 877 52 Plus
Dyak\GE26311-PA 405 GE26311-PA 108..398 347..636 763 46.2 Plus
Dyak\GE13841-PA 672 GE13841-PA 38..307 364..633 526 37.9 Plus
Dyak\GE24610-PA 640 GE24610-PA 8..276 363..632 519 37.3 Plus

FI05259.hyp Sequence

Translation from 480 to 2399

> FI05259.hyp
MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILK
SSNRPLPLVDPSEITPTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGS
MAPMNPMAPGAHPMMSHGPGMMMPPETGGIVLPKTSHVARSNSLRSSSPP
RVRRVANVPPSVPEEEGPPAAGTPGVGGASSGGFKPPGAHPSLLYNSQHA
HANGATGPLAVRTDQTNLQQYRSNLAPPSGGSMPQQQQTSPVGSVASGTR
SNHSHTNNGNSGGSYPPMYPTSHQQQQQQQQQAKQGGDQNQNPLHPHAHP
HPHHHQHLAKSASRASSSSGGASSAAQQASGASGGAAGQPKQDQRLTHEQ
FRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGAL
TDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGR
VKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGI
MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRML
VRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNARHHP*

FI05259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-PA 639 CG18582-PA 1..639 1..639 3369 100 Plus
Pak-PJ 704 CG10295-PJ 75..698 3..636 939 36.4 Plus
Pak-PE 704 CG10295-PE 75..698 3..636 939 36.4 Plus
Pak-PB 704 CG10295-PB 75..698 3..636 939 36.4 Plus
Pak-PA 704 CG10295-PA 75..698 3..636 939 36.4 Plus