Clone FI05269 Report

Search the DGRC for FI05269

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:69
Vector:pOT2
Associated Gene/TranscriptMdr49-RA
Protein status:FI05269.pep: gold
Sequenced Size:4229

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Mdr49 2008-08-15 Release 5.9 accounting
Mdr49 2008-12-18 5.12 accounting

Clone Sequence Records

FI05269.complete Sequence

4229 bp assembled on 2008-07-17

GenBank Submission: BT044206.1

> FI05269.complete
CACTCGTCGGCTGCAGACGTCTTCTTGAGCACTTCCCAGTGCGAATAGAG
CCAGAGGAAATATAGATATATATATACATATATAAAGTCTTCAGACGATC
GCGAGTTTCATCAGTTTGCCAAGTGTCCACGGAAGATCGGCACGTGCTAA
GCTTAATTGCTATAGCGAGTATAGAGATACTTTACTGCAGTATCACCTCA
TAGACACAATGGTCAAGAAGGAGGAATCACGGCTGCCACAAGCTGGTGAC
TTTCAGCTTAAGGAAGGATCAGTCGTGGATGCGACCCGAAAGTACAGTTA
CTTTGATCTGTTCAGATACTCAACCAGATGCGAGCGCTTCCTGTTGGTAG
TCAGTCTGCTGGTGGCCACCGCTGCGTCCGCATTTATTCCCTACTTCATG
ATTATCTACGGAGAGTTCACATCCCTGCTCGTGGACCGAACAGTCGGCGT
GGGCACATCCTCGCCAGCCTTTGCTCTGCCCATGTTTGGTGGCGGTCAGC
AATTGACAAATGCCAGCAAAGAGGAGAACAACCAGGCGATCATTGATGAT
GCGACTGCCTTTGGCATTGGCAGTCTGGTGGGATCTGTGGCCATGTTCCT
GCTCATCACACTGGCCATCGACTTGGCCAACCGGATAGCCCTCAACCAAA
TCGATCGCATCCGAAAGCTCTTCCTGGAGGCAATGCTGCGACAGGACATC
GCCTGGTACGACACCAGTTCGGGCTCCAACTTCGCCAGCAAAATGACAGA
AGACCTGGACAAACTGAAGGAAGGCATTGGCGAGAAAATAGTGATTGTGG
TATTCCTGATCATGACCTTTGTGATTGGAATAGTGTCTGCTTTCGTCTAC
GGATGGAAGCTCACCCTGGTCGTTCTAAGTTGTGTGCCCTTCATCATTGC
AGCCACCAGTGTGGTGGCTCGACTCCAGGGATCGCTGGCCGAGAAGGAGC
TGAAGTCCTACTCCGATGCAGCCAACGTGGTCGAGGAGGTATTCAGTGGA
ATTCGCACAGTGTTCGCATTCAGTGGTCAGGAGAAGGAGAAGGAACGCTT
TGGCAAGCTGCTCATTCCCGCAGAGAATACGGGTCGCAAGAAGGGTCTAT
ACTCGGGCATGGGGAACGCTCTGTCCTGGCTGATCATCTACCTGTGCATG
GCCCTTGCCATCTGGTATGGTGTGACGCTCATTCTGGACGAGCGTGATCT
TCCCGATCGCGTTTATACTCCGGCCGTTCTGGTCATTGTCCTGTTCGCCG
TGATCATGGGTGCCCAGAATCTCGGTTTTGCCTCTCCACACGTGGAAGCC
ATTGCTGTGGCCACGGCAGCTGGCCAGACCCTGTTCAACATCATCGATCG
TCCGTCGCAGGTGGATCCAATGGACGAGAAGGGAAACAGGCCGGAGAATA
CCGCTGGACACATTCGTTTCGAGGGCATACGCTTCCGTTACCCCGCCCGT
CCGGATGTGGAGATCCTCAAGGGTCTGACCGTCGATGTGCTTCCGGGTCA
GACGGTGGCCTTCGTGGGCGCATCTGGGTGTGGCAAGAGCACCCTCATCC
AACTGATGCAGCGGTTCTACGACCCCGAAGCGGGCAGTGTCAAACTGGAT
GGACGGGATCTTCGAACACTGAATGTGGGCTGGTTGCGTTCGCAGATCGG
AGTGGTGGGCCAGGAACCGGTTCTCTTCGCCACCACCATTGGCGAGAATA
TCCGATACGGAAGACCATCGGCCACTCAGGCGGATATAGAGAAGGCGGCG
CGAGCGGCCAACTGTCATGATTTCATCACTCGCCTACCCAAGGGCTACGA
CACCCAGGTGGGCGAGAAGGGCGCTCAGATTTCTGGTGGCCAGAAGCAGC
GGATTGCCATTGCCCGGGCTTTGGTTCGACAGCCCCAAGTGCTTCTTCTC
GACGAGGCCACCTCTGCCCTGGATCCCACCTCTGAGAAGCGGGTGCAAAG
TGCCCTAGAACTGGCCAGCCAGGGACCAACCACTCTAGTTGTGGCCCACC
GACTGTCCACCATCACCAATGCCGACAAGATTGTCTTCCTCAAGGACGGT
GTAGTGGCGGAGCAGGGTACGCACGAGGAGCTCATGGAGCGACGTGGTCT
CTACTGCGAACTGGTGAGCATCACCCAGCGGAAGGAGGCCACGGAGGCGG
ACGAGGGAGCGGTTGCCGGGCGACCTCTGCAGAAGTCGCAGAACCTGTCT
GACGAGGAAACCGATGATGACGAGGAGGATGAAGAGGAGGACGAAGAGCC
GGAGCTGCAGACTTCGGGCAGCTCCAGGGACAGCGGATTCAGAGCCAGCA
CGCGACGCAAGCGTCGCTCGCAGCGTCGCAAGAAGAAGAAGGACAAGGAA
GTGGTATCCAAGGTGTCCTTCACTCAACTAATGAAGCTTAATTCTCCGGA
GTGGCGTTTCATTGTCGTCGGAGGCATTGCATCCGTAATGCATGGCGCCA
CATTCCCGCTTTGGGGTCTCTTCTTTGGCGACTTCTTTGGAATCCTCTCG
GACGGTGACGATGACGTTGTGCGAGCCGAGGTCCTAAAAATCTCCATGAT
CTTTGTGGGCATTGGCCTGATGGCCGGATTGGGTAACATGCTCCAGACCT
ACATGTTCACAACGGCCGGCGTGAAGATGACAACGCGATTGCGTAAACGG
GCTTTTGGAACGATTATTGGTCAGGATATTGCCTACTTCGATGACGAGCG
GAATTCAGTGGGAGCACTGTGCTCCCGGCTGGCCAGCGATTGTTCCAACG
TTCAGGGTGCAACCGGAGCTCGTGTGGGCACAATGCTCCAGGCCGTGGCC
ACTCTTGTGGTCGGAATGGTCGTCGGTTTCGTTTTCTCCTGGCAACAGAC
GCTCCTCACACTGGTCACCCTGCCACTGGTCTGTTTGTCCGTCTACTTGG
AGGGTCGTTTTATCATGAAGAGCGCCCAAAAGGCTAAGGCGTCGATCGAG
GAGGCTTCTCAAGTGGCAGTCGAAGCTATTACCAATATCCGAACGGTCAA
TGGTCTTTGCCTAGAGCGCCAGGTCTTGGATCAGTACGTTCAGCAGATCG
ATCGCGTGGATATCGCCTGCAGGCGCAAGGTTCGCTTCCGTGGTCTGGTT
TTCGCTCTGGGACAGGCGGCTCCTTTCCTGGCTTACGGCATCTCAATGTA
CTATGGTGGTATTCTGGTGGCAGAGGAGCGAATGAACTATGAGGACATCA
TCAAGGTGGCCGAGGCTCTGATCTTTGGCTCCTGGATGTTGGGACAGGCC
CTGGCCTACGCGCCAAATGTAAACGATGCTATTCTGTCCGCCGGACGCCT
AATGGATCTCTTCAAGCGCACCTCCACGCAGCCCAATCCGCCACAGAGTC
CCTACAATACAGTTGAGAAATCCGAGGGAGACATTGTCTATGAAAACGTG
GGCTTCGAATATCCCACCAGGAAGGGCACTCCCATTCTGCAGGGCCTAAA
TCTCACCATCAAGAAATCGACGACGGTAGCTCTGGTGGGTCCATCTGGTT
CCGGCAAGTCCACCTGCGTGCAACTGCTGCTTCGCTACTACGATCCCGTA
TCGGGATCCGTGAATCTGAGCGGAGTGCCGAGCACGGAATTCCCGTTGGA
CACACTGCGCTCCAAGCTGGGCCTGGTCTCGCAGGAACCCGTGCTCTTCG
ATCGCACCATTGCCGAGAACATAGCTTATGGCAACAATTTCCGTGACGAT
GTGTCCATGCAGGAGATTATTGAGGCGGCCAAGAAGTCGAATATCCACAA
CTTTATAAGTGCTTTGCCCCAAGGCTACGACACCCGACTGGGCAAGACCT
CGCAGCTCTCTGGAGGTCAGAAGCAGCGCATCGCCATCGCTCGAGCCCTG
GTCAGAAACCCGAAGATACTCATCCTGGACGAGGCAACCTCTGCGCTGGA
CTTGGAGAGCGAGAAGGTGGTGCAACAGGCGCTGGATGAGGCGAGATCAG
GCCGCACATGCCTGACGATTGCGCATCGTCTGACCACCGTGCGGAATGCG
GATCTCATCTGTGTGCTAAAACGCGGCGTGGTAGTGGAGCACGGCACCCA
CGATGAGTTGATGGCACTGAACAAAATCTACGCCAATCTCTATCTGATGC
AGCAGGTGTCGGGCTAACACAGCGAACTGGAGTGATAATTGTTAGGCTTT
AATTTAGTATGTACACTAGGCTAATTGAACATGTTGAAGTATTACAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI05269.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-RA 4312 Mdr49-RA 89..4297 1..4203 20525 99.2 Plus
Mdr49-RB 3624 Mdr49-RB 157..3609 751..4203 16890 99.2 Plus
Mdr50-RA 4256 Mdr50-RA 3741..3867 3812..3938 155 74.8 Plus
Mdr50-RA 4256 Mdr50-RA 1628..1693 1645..1710 150 81.8 Plus
Mdr50-RA 4256 Mdr50-RA 3715..3769 1809..1863 140 83.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8829900..8831463 2314..751 7730 99.6 Minus
chr2R 21145070 chr2R 8827671..8828500 4195..3366 4075 99.4 Minus
chr2R 21145070 chr2R 8828569..8829177 3367..2759 2910 98.5 Minus
chr2R 21145070 chr2R 8829280..8829726 2759..2313 2160 98.9 Minus
chr2R 21145070 chr2R 8831847..8832092 750..505 1230 100 Minus
chr2R 21145070 chr2R 8832151..8832346 505..310 980 100 Minus
chr2R 21145070 chr2R 8832411..8832570 310..151 785 99.4 Minus
chr2R 21145070 chr2R 8833500..8833656 151..1 645 95.5 Minus
chr3L 24539361 chr3L 6235520..6235617 3900..3803 235 82.7 Minus
chr3L 24539361 chr3L 6229459..6229571 1924..1812 205 78.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-RA 3909 CG3879-PA 1..3909 209..4117 19170 99.4 Plus
Mdr49-RB 3306 CG3879-PB 1..3306 812..4117 16155 99.2 Plus
Mdr65-RA 3909 CG10181-PA 1627..1724 3803..3900 235 82.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-RA 4240 CG3879-RA 17..4217 1..4195 20475 99.2 Plus
Mdr49-RB 3624 CG3879-RB 157..3601 751..4195 16850 99.3 Plus
Sans-RB 1898 CG13320-RB 1832..1898 4195..4129 335 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-PA 1302 CG3879-PA 1..1302 209..4114 6118 100 Plus
Mdr49-PB 1101 CG3879-PB 1..1101 812..4114 5196 100 Plus
Mdr65-PA 1302 CG10181-PA 25..1300 275..4105 2784 44.9 Plus
Mdr50-PA 1313 CG8523-PA 45..1309 218..4102 2428 42.1 Plus
CG10226-PA 1320 CG10226-PA 23..658 254..2146 1421 45.9 Plus
Mdr49-PB 1101 CG3879-PB 609..1098 656..2128 803 38.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12942575..12944138 2314..751 7730 99.6 Minus
2R 25286936 2R 12940338..12941175 4203..3366 4115 99.4 Minus
2R 25286936 2R 12941244..12941852 3367..2759 2910 98.5 Minus
2R 25286936 2R 12941955..12942401 2759..2313 2160 98.9 Minus
2R 25286936 2R 12944522..12944767 750..505 1230 100 Minus
2R 25286936 2R 12944826..12945021 505..310 980 100 Minus
2R 25286936 2R 12945086..12945245 310..151 785 99.4 Minus
2R 25286936 2R 12946175..12946331 151..1 645 95.5 Minus
3L 28110227 3L 6243010..6243107 3900..3803 235 82.7 Minus
3L 28110227 3L 6236952..6237064 1924..1812 205 78.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12943774..12945337 2314..751 7730 99.6 Minus
2R 25260384 2R 12941537..12942374 4203..3366 4115 99.4 Minus
2R 25260384 2R 12942443..12943051 3367..2759 2910 98.5 Minus
2R 25260384 2R 12943154..12943600 2759..2313 2160 98.8 Minus
2R 25260384 2R 12945721..12945966 750..505 1230 100 Minus
2R 25260384 2R 12946025..12946220 505..310 980 100 Minus
2R 25260384 2R 12946285..12946444 310..151 785 99.3 Minus
2R 25260384 2R 12947374..12947530 151..1 655 95.5 Minus
3L 28103327 3L 6236110..6236207 3900..3803 235 82.6 Minus
3L 28103327 3L 6230052..6230164 1924..1812 205 78.7 Minus
2R 25260384 2R 14253219..14253308 3812..3901 150 77.7 Plus
2R 25260384 2R 14250852..14250917 1645..1710 150 81.8 Plus
2R 25260384 2R 14253193..14253247 1809..1863 140 83.6 Plus
Blast to na_te.dros performed on 2014-11-27 03:23:50 has no hits.

FI05269.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:23:10 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8832411..8832570 151..310 99 <- Minus
chr2R 8832152..8832345 311..504 100 <- Minus
chr2R 8831847..8832092 505..750 100 <- Minus
chr2R 8829902..8831463 751..2312 99 <- Minus
chr2R 8829281..8829726 2313..2758 98 <- Minus
chr2R 8828569..8829177 2759..3367 98 <- Minus
chr2R 8827671..8828498 3368..4195 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:05 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 1..3909 209..4117 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:36 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 1..3909 209..4117 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:43 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 1..3909 209..4117 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:54:05 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 1..3909 209..4117 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:23:10 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 1..3909 209..4117 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:10 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 14..4214 1..4195 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:36 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 15..4215 1..4195 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:43 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 17..4217 1..4195 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:54:05 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 14..4214 1..4195 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:23:10 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 17..4217 1..4195 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:23:10 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12946176..12946331 1..150 95   Minus
2R 12945086..12945245 151..310 99 <- Minus
2R 12944827..12945020 311..504 100 <- Minus
2R 12944522..12944767 505..750 100 <- Minus
2R 12942577..12944138 751..2312 99 <- Minus
2R 12941956..12942401 2313..2758 98 <- Minus
2R 12941244..12941852 2759..3367 98 <- Minus
2R 12940346..12941173 3368..4195 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:43 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8833681..8833836 1..150 95   Minus
arm_2R 8832591..8832750 151..310 99 <- Minus
arm_2R 8832332..8832525 311..504 100 <- Minus
arm_2R 8832027..8832272 505..750 100 <- Minus
arm_2R 8830082..8831643 751..2312 99 <- Minus
arm_2R 8829461..8829906 2313..2758 98 <- Minus
arm_2R 8828749..8829357 2759..3367 98 <- Minus
arm_2R 8827851..8828678 3368..4195 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:38 Download gff for FI05269.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12947375..12947530 1..150 95   Minus
2R 12946285..12946444 151..310 99 <- Minus
2R 12946026..12946219 311..504 100 <- Minus
2R 12945721..12945966 505..750 100 <- Minus
2R 12943776..12945337 751..2312 99 <- Minus
2R 12943155..12943600 2313..2758 98 <- Minus
2R 12942443..12943051 2759..3367 98 <- Minus
2R 12941545..12942372 3368..4195 99 <- Minus

FI05269.pep Sequence

Translation from 208 to 4116

> FI05269.pep
MVKKEESRLPQAGDFQLKEGSVVDATRKYSYFDLFRYSTRCERFLLVVSL
LVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGGQQLT
NASKEENNQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDR
IRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFL
IMTFVIGIVSAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKS
YSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYSG
MGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIM
GAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAG
HIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLM
QRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRY
GRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIA
IARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLS
TITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADEG
AVAGRPLQKSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRR
KRRSQRRKKKKDKEVVSKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFP
LWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYMF
TTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQG
ATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGR
FIMKSAQKAKASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRV
DIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDIIKV
AEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPYN
TVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGK
STCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRT
IAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTSQL
SGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRT
CLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQV
SG*

FI05269.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11993-PA 1307 GF11993-PA 1..1307 1..1302 6001 90 Plus
Dana\GF10905-PA 1302 GF10905-PA 25..1300 23..1299 2982 45.7 Plus
Dana\GF10906-PA 1317 GF10906-PA 35..1313 30..1298 2761 43.6 Plus
Dana\GF13488-PA 1309 GF13488-PA 68..1305 27..1298 2545 41.7 Plus
Dana\GF20900-PA 740 GF20900-PA 197..705 135..648 851 37.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22536-PA 1302 GG22536-PA 4..1302 3..1302 6378 96.2 Plus
Dere\GG14065-PA 1302 GG14065-PA 25..1300 23..1299 2990 45.5 Plus
Dere\GG14066-PA 1318 GG14066-PA 35..1314 30..1298 2752 43.4 Plus
Dere\GG20437-PA 1308 GG20437-PA 73..1307 31..1298 2589 42.7 Plus
Dere\GG19546-PA 758 GG19546-PA 199..720 135..658 841 37.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21602-PA 1327 GH21602-PA 13..1327 3..1302 5165 75.2 Plus
Dgri\GH16282-PA 1301 GH16282-PA 25..1299 23..1299 3042 45.7 Plus
Dgri\GH16283-PA 1306 GH16283-PA 34..1302 30..1298 2774 43.8 Plus
Dgri\GH21790-PA 1305 GH21790-PA 69..1301 24..1298 2503 41.6 Plus
Dgri\GH24830-PA 723 GH24830-PA 196..690 137..636 852 38.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-PA 1302 CG3879-PA 1..1302 1..1302 6540 100 Plus
Mdr49-PB 1101 CG3879-PB 1..1101 202..1302 5547 100 Plus
Mdr65-PA 1302 CG10181-PA 25..1300 23..1299 2878 45.1 Plus
CG10226-PA 1320 CG10226-PA 23..1316 16..1298 2678 43 Plus
Mdr50-PA 1313 CG8523-PA 45..1309 4..1298 2569 42.1 Plus
Mdr49-PB 1101 CG3879-PB 513..1098 24..640 814 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19571-PA 1319 GI19571-PA 4..1319 2..1302 5139 76.4 Plus
Dmoj\GI13225-PA 1303 GI13225-PA 27..1301 23..1299 3034 45.4 Plus
Dmoj\GI13227-PA 1311 GI13227-PA 33..1310 30..1301 2821 43.7 Plus
Dmoj\GI16162-PA 724 GI16162-PA 192..721 137..671 858 37.2 Plus
Dmoj\GI16162-PA 724 GI16162-PA 193..690 798..1299 769 38.2 Plus
Dmoj\GI16313-PA 699 GI16313-PA 203..692 145..637 722 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10597-PA 1300 GL10597-PA 7..1300 3..1302 5680 83.5 Plus
Dper\GL10123-PA 1300 GL10123-PA 47..1296 3..1298 2461 40.6 Plus
Dper\GL22523-PA 767 GL22523-PA 2..765 534..1299 1707 45.9 Plus
Dper\GL22524-PA 1284 GL22524-PA 38..657 24..638 1502 48.1 Plus
Dper\GL22524-PA 1284 GL22524-PA 784..1280 814..1298 1156 46 Plus
Dper\GL22523-PA 767 GL22523-PA 173..760 17..635 915 37 Plus
Dper\GL22524-PA 1284 GL22524-PA 786..1276 156..635 765 35.7 Plus
Dper\GL22524-PA 1284 GL22524-PA 8..654 670..1294 749 30.2 Plus
Dper\GL20384-PA 590 GL20384-PA 1..573 716..1289 743 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17746-PA 1300 GA17746-PA 7..1300 3..1302 5661 83.7 Plus
Dpse\GA10136-PA 1309 GA10136-PA 24..1307 23..1299 2955 45.4 Plus
Dpse\GA24563-PA 1323 GA24563-PA 36..1319 24..1298 2752 43.2 Plus
Dpse\GA21135-PA 1313 GA21135-PA 47..1309 3..1298 2546 41.7 Plus
Dpse\GA14849-PA 743 GA14849-PA 211..735 137..676 843 36.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20322-PA 1302 GM20322-PA 1..1302 1..1302 6876 99.2 Plus
Dsec\GM13846-PA 1302 GM13846-PA 25..1300 23..1299 2984 45.3 Plus
Dsec\GM13848-PA 1318 GM13848-PA 35..1314 30..1298 2770 43.4 Plus
Dsec\GM21523-PA 1313 GM21523-PA 69..1309 27..1298 2562 42.4 Plus
Dsec\GM11542-PA 758 GM11542-PA 202..708 135..646 844 37.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25799-PA 702 GD25799-PA 1..702 1..702 3558 98.9 Plus
Dsim\GD13132-PA 1302 GD13132-PA 25..1300 23..1299 2975 45.1 Plus
Dsim\GD13133-PA 1318 GD13133-PA 35..1314 30..1298 2766 43.5 Plus
Dsim\GD11033-PA 1313 GD11033-PA 69..1309 27..1298 2569 42.6 Plus
Dsim\GD25800-PA 444 GD25800-PA 1..444 859..1302 2229 99.5 Plus
Dsim\GD25799-PA 702 GD25799-PA 28..640 718..1299 822 33.9 Plus
Dsim\GD11033-PA 1313 GD11033-PA 45..668 659..1298 805 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21146-PA 1253 GJ21146-PA 91..1253 148..1302 4850 78.5 Plus
Dvir\GJ12000-PA 1303 GJ12000-PA 27..1301 23..1299 3031 45.2 Plus
Dvir\GJ12001-PA 1310 GJ12001-PA 26..1298 30..1298 2826 44.1 Plus
Dvir\GJ20066-PA 1306 GJ20066-PA 71..1302 31..1298 2623 42.5 Plus
Dvir\GJ22389-PA 1307 GJ22389-PA 71..1303 31..1298 2564 41.9 Plus
Dvir\GJ21146-PA 1253 GJ21146-PA 12..91 3..79 271 61.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20875-PA 1302 GK20875-PA 7..1302 4..1302 5430 79.8 Plus
Dwil\GK13588-PA 1303 GK13588-PA 32..1301 30..1299 3050 46.4 Plus
Dwil\GK13599-PA 1325 GK13599-PA 42..1321 30..1298 2819 44 Plus
Dwil\GK20780-PA 1313 GK20780-PA 69..1309 24..1298 2550 42.4 Plus
Dwil\GK25432-PA 734 GK25432-PA 206..712 135..646 859 37.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13408-PA 1302 GE13408-PA 1..1302 1..1302 6424 97.6 Plus
Dyak\GE20489-PA 1302 GE20489-PA 25..1300 23..1299 2997 45.7 Plus
Dyak\GE20490-PA 1318 GE20490-PA 35..1314 30..1298 2747 43.4 Plus
Dyak\GE13568-PA 1311 GE13568-PA 45..1307 4..1298 2594 42.1 Plus
Dyak\GE16208-PA 756 GE16208-PA 200..706 135..646 842 37.5 Plus

FI05269.hyp Sequence

Translation from 208 to 4116

> FI05269.hyp
MVKKEESRLPQAGDFQLKEGSVVDATRKYSYFDLFRYSTRCERFLLVVSL
LVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGGQQLT
NASKEENNQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDR
IRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFL
IMTFVIGIVSAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKS
YSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYSG
MGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIM
GAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAG
HIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLM
QRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRY
GRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIA
IARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLS
TITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADEG
AVAGRPLQKSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRR
KRRSQRRKKKKDKEVVSKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFP
LWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYMF
TTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQG
ATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGR
FIMKSAQKAKASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRV
DIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDIIKV
AEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPYN
TVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGK
STCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRT
IAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTSQL
SGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRT
CLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQV
SG*

FI05269.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-PA 1302 CG3879-PA 1..1302 1..1302 6540 100 Plus
Mdr49-PB 1101 CG3879-PB 1..1101 202..1302 5547 100 Plus
Mdr65-PA 1302 CG10181-PA 25..1300 23..1299 2878 45.1 Plus
CG10226-PA 1320 CG10226-PA 23..1316 16..1298 2678 43 Plus
Mdr50-PA 1313 CG8523-PA 45..1309 4..1298 2569 42.1 Plus
Mdr49-PB 1101 CG3879-PB 513..1098 24..640 814 33.5 Plus