Clone FI05272 Report

Search the DGRC for FI05272

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:72
Vector:pOT2
Associated Gene/Transcriptraw-RB
Protein status:FI05272.pep: gold
Sequenced Size:3208

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
raw 2008-08-15 Release 5.9 accounting
raw 2008-12-18 5.12 accounting

Clone Sequence Records

FI05272.complete Sequence

3208 bp assembled on 2008-07-17

GenBank Submission: BT044207.1

> FI05272.complete
AGAACCCAACAGTTTCCTAATGCAAATACAATAAACTAATTGTTTAAAAT
GTGACAACAGTGAACCAAATGCTTGCTGAGTAATAAACCAAAGGATGTTT
TGTTTTTTTCTAAAACGTGCCAAGTGAATCGGCTCCACGCAAATGAGAGT
GCGGTCTGAAAACAATGGAGCTGCCGTAAAGAATTGATTAAACAAAATAG
TCGAGAAGAGAGCGCAAAATGCACAAAATGGTTAAATTATTCCTCAGAGA
AGTTCTGAATGCATGGCGAGCAAAGGCCAGATGCAATGTGGTGCCCGACG
AACGGACACAGGAACTCTTCCACGAGCTAAGCTTCCATCCTAGCCAAAAG
CAGATTAGCGAAATGCTGCAGACTGCCAAGAAAGTGGCCCGCAAGGGAGG
AAGTGGACAGGCAAATGGGCTGACTTTTGGCCAGTTTTGTGTCTTAGCCG
CGGATCTGAAACGTTTCAGAGCTTCAACAATTTCGAATCAGCCATCGTAC
TGCGACTATCAGTCTCTGTCCGCGGGACTGCTGCTCCCGGAACTAGATGA
TCCTGCCAGCTCGTCCAATCAAAACCTTCAGTCGCCAGCGGCCACCAACT
CGTCACCTGCGCACAGCTCCAAGAAGCCGGATAACCACGGTACCGAACTG
AGGAGTACCAAGTCCTTTAGCAGTGTGGACGATACCAAAAAGAAAAAGAA
CGCCACCAATGAGCCCGTCGAGGTTTTCCTTGGCGGATCCTGCAATCCGA
CAACCTGGCGAGCCGACGTTGCCATACCAGCCCTCAAGGAGCTGGGCATT
TCGTTTTACAATCCTCAAGTATCCGATTGGACGCCCGATCTCATCGAGCT
CGAGCATCGAGCTAAGGAAAAGGCCCGTGTATTATTCTTCGTTATGGATT
CGGAAACACGCGCATCTGCTGGTGCCATCGAGGCGGCACACATAGCGGGT
CAAAACTGCAAGCAGCTGGTGTTGGTTTTGCATCCGTATAAACCAAATCA
GAAGATCCTCAATGAGCCTATTTCGCAGCAAGAATACCTCGATCTGAATC
GCAATCAGTTGATACTTAAGGAGCTGGTCTCCCGACGCGGTCTGCCCGTA
TTGGATAACATACCACTGGGTCTGCAGCGCACTAAGGATATCCTGGGTGG
CATCAGGGATCCACCGTCCAAAATATCTTCTATTTTAGATACCGTTCGCG
GCGCCTTTGATCGTGTTAATCCGCTAAACGATCTGCTCACTGTGGAACAA
TGCAAACGTGCTCTCTTATTCCTAGGCTATGCTCAGAGTTTAGTTAATTT
AGACAATCTAAATAAGATCATTATCAACCAACGCGAATCGCTGAAATTGC
TCCAAACGCACAGTCCAAGAGCTGTCGCCGATGATGCGGATGCCGATGGC
GGCAACTGCAGCCAGCCCATCCTCCCCAGCCAGGAGCTCATCGACTTTGA
TCTGTTTTGTGTGATCTCGGCGTATCTGTCCGTCCTGCAGCAGGAGATCC
ATGAGAGCGGATGCATTTCGCCCATCAAGGGCACCAATGTGCCGCCACCG
CAAGTTTACTTCACCAACGCTCCCGATGTGGACATTTACTACTCGGCCAG
CAAGAATATTTCGCGCACGTCGAGCAACGCCAGTGTTCCGTCCAATAGTA
GCAGTGGCATCGGACACGACCTGGAGCGCCAGAGTCTCTTCGAGCAGCTC
AGTCGCAGCCGGGACAGTGGAACATCTTCGCCACAGCCCACGGGATCGAG
CAGTTTGGGTAAAAGCCCTCGGCCACAGATCCTGCTAAATGTGGAGTCGA
TCGAGACAACGGAAATAATCACCACTAAAACCATAGAGACCAAGCCAAAT
CCGGTGACTGCATCAACTGTTGTGCATGCCGAGGAGGAAGAGAGTGATTC
CAACGACTCGGTCCTCTCCAGCAACAGCTCCATAGCCAGTGCCGGCGATA
TACTCTGCTGCGGTGGTGGCTTGGATCTGCGGGATGTCTATCTGGGCGGA
AGTTGTGTGCTGCGCACCAAGTGGCGTCAGGAACTGGCCGTGCCCTATCT
GCAGTCCAAGGGCGTCAGTTTCCATACACCGGCGCTGCACGAGAGCATCC
AGCAAATGATTCTGAACCAGGAACAGAACCAGGATCAGTCTCAGCAGCCG
ACAGTGCCGCCGCAGGAACAGCAGCAACAGCAGCGTTCCTTTGTGCGCAC
TCGGCGAAAGTGCAGGGGCAACCAGCTGCAGCTGGAGGAGCAAGAGGAGC
TGACCGTGGCCGAGGAGTCACTTAGCTGGTCCCTACCACCGGTCGCCGTT
CGTCAGAGCCTGTTCAACCCATCGCTGCTCGACTCGAGTCGAGTGTTGCT
CTTCGTCATCACCAACGAGACCCGTTCGCTGGCGCCCATGACCCTGGCCG
CCCACTGCATTGGCCTCATGTACAATGTGGTGCTGGCGGTGCAAATGCTG
CCCGAAGACTGTGTCCTGGGTGACGAGAAGCTGACTGTGGCGGCCATCAA
GGACTACAATCGCGGACGGTCGTACCTGATCGACTTGGCCAAGAGGCAGG
GTGTGCCCGTGTTCAGCGACATTCGGGCAGCCCTCGAGTGCACCGTGGCC
AAGGTGAAGGCGTACAACAACCGCGACCGCTGCTAAATCGTACCTGTATT
TAAGTTCCAGCACGTGACAATTTAAGCTTATCTTTAAGTCTAAGGATTAG
TGCAATTTACGTTCTACTCTTAACCCCCACTAACTTAAATGGTGTCTGAT
CGTATTCGGAGAACACTCTTCTACCTAGTTAACGCTATACGTAATATTAT
ATAGATGATACAAATAACAAGTGTAAAACCACTAAAATGTCGTCGCCCAG
AGAGCGCATTTCATAACCTTATGGAGAAAGTCTTGCATTCAGCTCCACTC
TCTCTATGATCGCTATAAGCTATTTGCTTTATGCTAATTTATTATTTATT
TAACACCATACGCGTGGTACATGTGCTAAATTAAATGTAAATATTCGAAC
GTGTACAATTCTTAGTGCATATATGTACAATGAAACACCAACTAAAATAT
ATATATATATTATAATCATAGTGAGCATTCAGATCTAAAATAATATCTAT
ATAAAAGCCCCATCATGTATATGTATACCCATAGTGACCCACTGTACCAG
TTAGCTGGCAAAAAATATCTCAATAAACCAATTTTTCTAACAAAAAAAAA
AAAAAAAA

FI05272.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
raw-RB 3237 raw-RB 37..3228 1..3192 15960 100 Plus
raw.a 3757 raw.a 803..3748 247..3192 14730 100 Plus
raw-RA 3784 raw-RA 830..3775 247..3192 14730 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8709607..8710518 2480..1569 4515 99.7 Minus
chr2L 23010047 chr2L 8708760..8709472 3191..2479 3490 99.3 Minus
chr2L 23010047 chr2L 8710583..8710960 1567..1190 1890 100 Minus
chr2L 23010047 chr2L 8711554..8711902 815..467 1730 99.7 Minus
chr2L 23010047 chr2L 8739262..8739516 247..1 1090 96.1 Minus
chr2L 23010047 chr2L 8711268..8711482 1030..816 1075 100 Minus
chr2L 23010047 chr2L 8711025..8711183 1189..1031 795 100 Minus
chr2L 23010047 chr2L 8712144..8712253 354..245 550 100 Minus
chr2L 23010047 chr2L 8711969..8712083 469..355 545 98.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
raw-RB 2418 CG12437-PB 1..2418 219..2636 12090 100 Plus
raw-RC 2970 CG12437-PC 581..2970 247..2636 11950 100 Plus
raw-RE 2970 CG12437-PE 581..2970 247..2636 11950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
raw-RB 3220 CG12437-RB 30..3220 1..3191 15955 100 Plus
raw-RC 3954 CG12437-RC 1010..3954 247..3191 14725 100 Plus
raw-RE 4275 CG12437-RE 1331..4275 247..3191 14725 100 Plus
raw-RC 3954 CG12437-RC 30..276 1..247 1235 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
raw-PB 805 CG12437-PB 1..805 219..2633 3366 100 Plus
raw-PC 989 CG12437-PC 187..989 225..2633 3324 99.1 Plus
raw-PE 989 CG12437-PE 187..989 225..2633 3324 99.1 Plus
raw-PA 989 CG12437-PA 187..989 225..2633 3324 99.1 Plus
raw-PD 832 CG12437-PD 36..832 243..2633 3316 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8710727..8711638 2480..1569 4560 100 Minus
2L 23513712 2L 8709879..8710592 3192..2479 3570 100 Minus
2L 23513712 2L 8711701..8712080 1569..1190 1900 100 Minus
2L 23513712 2L 8712674..8713022 815..467 1745 100 Minus
2L 23513712 2L 8740385..8740631 247..1 1235 100 Minus
2L 23513712 2L 8712388..8712602 1030..816 1075 100 Minus
2L 23513712 2L 8712145..8712303 1189..1031 795 100 Minus
2L 23513712 2L 8713089..8713203 469..355 575 100 Minus
2L 23513712 2L 8713264..8713373 354..245 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8710727..8711638 2480..1569 4560 100 Minus
2L 23513712 2L 8709879..8710592 3192..2479 3570 100 Minus
2L 23513712 2L 8711701..8712080 1569..1190 1900 100 Minus
2L 23513712 2L 8712674..8713022 815..467 1745 100 Minus
2L 23513712 2L 8740385..8740631 247..1 1235 100 Minus
2L 23513712 2L 8712388..8712602 1030..816 1075 100 Minus
2L 23513712 2L 8712145..8712303 1189..1031 795 100 Minus
2L 23513712 2L 8713089..8713203 469..355 575 100 Minus
2L 23513712 2L 8713264..8713373 354..245 550 100 Minus
Blast to na_te.dros performed 2014-11-27 03:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1046..1130 2103..2184 174 70.6 Plus
roo 9092 roo DM_ROO 9092bp 1060..1142 2099..2184 153 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1461..1584 2064..2184 152 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2375 2118..2186 138 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6826..6923 2089..2184 134 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6794 2103..2184 131 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6848 2112..2184 131 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2394 2116..2184 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6815 2116..2184 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6809..6893 2100..2184 119 63.2 Plus

FI05272.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:41:27 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8739262..8739516 1..247 96   Minus
chr2L 8712144..8712250 248..354 100 <- Minus
chr2L 8711969..8712083 355..469 98 <- Minus
chr2L 8711554..8711899 470..815 99 <- Minus
chr2L 8711268..8711482 816..1030 100 <- Minus
chr2L 8711025..8711183 1031..1189 100 <- Minus
chr2L 8710581..8710960 1190..1569 99 <- Minus
chr2L 8709607..8710517 1570..2480 99 <- Minus
chr2L 8708760..8709470 2481..3191 96 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:08 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 1..2418 219..2636 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:00 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 1..2418 219..2636 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:18 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 1..2418 219..2636 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:22 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 1..2418 219..2636 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:41:27 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 1..2418 219..2636 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:08 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 3..3193 1..3191 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:00 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 30..3220 1..3191 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:18 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 30..3220 1..3191 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:24 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 3..3193 1..3191 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:41:27 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 30..3220 1..3191 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:41:27 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8740385..8740631 1..247 100   Minus
2L 8713264..8713370 248..354 100 <- Minus
2L 8713089..8713203 355..469 100 <- Minus
2L 8712674..8713019 470..815 100 <- Minus
2L 8712388..8712602 816..1030 100 <- Minus
2L 8712145..8712303 1031..1189 100 <- Minus
2L 8711701..8712080 1190..1569 100 <- Minus
2L 8710727..8711637 1570..2480 100 <- Minus
2L 8709880..8710590 2481..3191 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:18 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8740385..8740631 1..247 100   Minus
arm_2L 8713264..8713370 248..354 100 <- Minus
arm_2L 8713089..8713203 355..469 100 <- Minus
arm_2L 8712674..8713019 470..815 100 <- Minus
arm_2L 8712388..8712602 816..1030 100 <- Minus
arm_2L 8712145..8712303 1031..1189 100 <- Minus
arm_2L 8711701..8712080 1190..1569 100 <- Minus
arm_2L 8710727..8711637 1570..2480 100 <- Minus
arm_2L 8709880..8710590 2481..3191 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:52 Download gff for FI05272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8740385..8740631 1..247 100   Minus
2L 8713264..8713370 248..354 100 <- Minus
2L 8713089..8713203 355..469 100 <- Minus
2L 8712674..8713019 470..815 100 <- Minus
2L 8712388..8712602 816..1030 100 <- Minus
2L 8712145..8712303 1031..1189 100 <- Minus
2L 8711701..8712080 1190..1569 100 <- Minus
2L 8710727..8711637 1570..2480 100 <- Minus
2L 8709880..8710590 2481..3191 100 <- Minus

FI05272.pep Sequence

Translation from 218 to 2635

> FI05272.pep
MHKMVKLFLREVLNAWRAKARCNVVPDERTQELFHELSFHPSQKQISEML
QTAKKVARKGGSGQANGLTFGQFCVLAADLKRFRASTISNQPSYCDYQSL
SAGLLLPELDDPASSSNQNLQSPAATNSSPAHSSKKPDNHGTELRSTKSF
SSVDDTKKKKNATNEPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQ
VSDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQL
VLVLHPYKPNQKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPL
GLQRTKDILGGIRDPPSKISSILDTVRGAFDRVNPLNDLLTVEQCKRALL
FLGYAQSLVNLDNLNKIIINQRESLKLLQTHSPRAVADDADADGGNCSQP
ILPSQELIDFDLFCVISAYLSVLQQEIHESGCISPIKGTNVPPPQVYFTN
APDVDIYYSASKNISRTSSNASVPSNSSSGIGHDLERQSLFEQLSRSRDS
GTSSPQPTGSSSLGKSPRPQILLNVESIETTEIITTKTIETKPNPVTAST
VVHAEEEESDSNDSVLSSNSSIASAGDILCCGGGLDLRDVYLGGSCVLRT
KWRQELAVPYLQSKGVSFHTPALHESIQQMILNQEQNQDQSQQPTVPPQE
QQQQQRSFVRTRRKCRGNQLQLEEQEELTVAEESLSWSLPPVAVRQSLFN
PSLLDSSRVLLFVITNETRSLAPMTLAAHCIGLMYNVVLAVQMLPEDCVL
GDEKLTVAAIKDYNRGRSYLIDLAKRQGVPVFSDIRAALECTVAKVKAYN
NRDRC*

FI05272.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14357-PA 998 GF14357-PA 189..998 3..805 3517 87.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24054-PA 805 GG24054-PA 1..805 1..805 3780 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13230-PA 968 GH13230-PA 190..967 3..804 2809 71.4 Plus
Dgri\GH23788-PA 369 GH23788-PA 32..366 132..451 1471 83.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
raw-PB 805 CG12437-PB 1..805 1..805 4115 100 Plus
raw-PC 989 CG12437-PC 187..989 3..805 4073 99.1 Plus
raw-PE 989 CG12437-PE 187..989 3..805 4073 99.1 Plus
raw-PA 989 CG12437-PA 187..989 3..805 4073 99.1 Plus
raw-PD 832 CG12437-PD 36..832 9..805 4065 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12397-PA 975 GI12397-PA 170..974 3..804 3117 82.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26218-PA 1095 GL26218-PA 299..1095 2..805 3285 85.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11633-PA 796 GA11633-PA 1..796 1..805 3261 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12748-PA 1002 GM12748-PA 197..1002 3..805 3635 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22386-PA 1001 GD22386-PA 197..1001 3..805 3784 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17880-PA 1048 GJ17880-PA 208..1048 3..805 3156 80.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18663-PA 815 GK18663-PA 1..815 1..805 3104 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10807-PA 963 GE10807-PA 159..963 3..805 3706 95.7 Plus

FI05272.hyp Sequence

Translation from 218 to 2635

> FI05272.hyp
MHKMVKLFLREVLNAWRAKARCNVVPDERTQELFHELSFHPSQKQISEML
QTAKKVARKGGSGQANGLTFGQFCVLAADLKRFRASTISNQPSYCDYQSL
SAGLLLPELDDPASSSNQNLQSPAATNSSPAHSSKKPDNHGTELRSTKSF
SSVDDTKKKKNATNEPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQ
VSDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQL
VLVLHPYKPNQKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPL
GLQRTKDILGGIRDPPSKISSILDTVRGAFDRVNPLNDLLTVEQCKRALL
FLGYAQSLVNLDNLNKIIINQRESLKLLQTHSPRAVADDADADGGNCSQP
ILPSQELIDFDLFCVISAYLSVLQQEIHESGCISPIKGTNVPPPQVYFTN
APDVDIYYSASKNISRTSSNASVPSNSSSGIGHDLERQSLFEQLSRSRDS
GTSSPQPTGSSSLGKSPRPQILLNVESIETTEIITTKTIETKPNPVTAST
VVHAEEEESDSNDSVLSSNSSIASAGDILCCGGGLDLRDVYLGGSCVLRT
KWRQELAVPYLQSKGVSFHTPALHESIQQMILNQEQNQDQSQQPTVPPQE
QQQQQRSFVRTRRKCRGNQLQLEEQEELTVAEESLSWSLPPVAVRQSLFN
PSLLDSSRVLLFVITNETRSLAPMTLAAHCIGLMYNVVLAVQMLPEDCVL
GDEKLTVAAIKDYNRGRSYLIDLAKRQGVPVFSDIRAALECTVAKVKAYN
NRDRC*

FI05272.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
raw-PB 805 CG12437-PB 1..805 1..805 4115 100 Plus
raw-PC 989 CG12437-PC 187..989 3..805 4073 99.1 Plus
raw-PE 989 CG12437-PE 187..989 3..805 4073 99.1 Plus
raw-PA 989 CG12437-PA 187..989 3..805 4073 99.1 Plus
raw-PD 832 CG12437-PD 36..832 9..805 4065 99.7 Plus