Clone FI05277 Report

Search the DGRC for FI05277

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:77
Vector:pOT2
Associated Gene/TranscriptCG6729-RA
Protein status:FI05277.pep: gold
Sequenced Size:2969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6729 2008-12-18 5.12 accounting

Clone Sequence Records

FI05277.complete Sequence

2969 bp assembled on 2008-08-28

GenBank Submission: BT044208.1

> FI05277.complete
CGAAAATGTTGGATGATTACTACACCTGGACTTACCCGGATATACCCGAA
AATGTGGCACAGGAGCTGCTGCAGCTGAACGGTTCGCTGGTAGTGGTCGG
AATCGTTGGCCGGTCGGATTGCGACCAGGCCAACAAGATGGTGGCTTTCG
GCATGGAGCCGCCTAGTGAGCACACACCCAAGGACGGCCAGATGCAGTGT
TACTACAAGCCGGGTACCTCCATCCTGCTGCTGCACTTCGAAAGCACCTA
CGACGCGGAGATTGCTGGCCAGATGATAGATGTCTGCATAGAGGATGTGG
ATACTCCCTTCGACATCGACAGCTTCTTCGAGGGGATACGATGTCGCTTC
GTGCGCATGATGCTGCTGGCCCTGCACGTTTGCCACATTGTGGTGTATGT
GGAAACTGGGCAGACGTTTGATCCGACACTAATCACCGTGTTCCAATTGG
CCAAGTTCGCCAGGGAACAGCATTTGATGCAGTTCTTGCCACAAATGCTT
AGAGAAACGCCTGCCGCCAGAATGAGCGAGCGCACACGACTGTGCACTCC
CAGGATTCTCTTCCTTTTCGAAAACTTTCCGAGCGACGAGCCAAAGACAC
GCGAATGCGTCTCTACATACGAGTTCCAGATGGAGGACTGCATCTATGAG
TTGTTGCGCCACCACAACATCGTGACCAATAGCAGCAGCAACTCGCTTGT
GGCACTTCCCAATAACAAACAGTTCGTCTTCTTCAACGCACACGAAGAGT
TGCGTGAGGACACGCTGATGAAGGCCGTCGAATGCCTCAATGAGACAATG
TACAAGCCGGATCTCAAAGAGGAGGAGGAAGACCTAGAGATCTTGGCGCT
GGCTCCCTTCGATGGCTTCGTCAAACCCTTCGCCTTGCCGGTCGATGAGA
AGGAGTGGGATAATCAGCAGTACAAGAAGGACCACACCGTGTGGAACTTT
CTGGAGCGACACGTTCAGGACGCCTTGATGGGTTGCTTTGAAGCGGGTTC
CTTCAAGCAGCATGCCCAGCAGGGTACGTTCCAACTCCTAAATAGCAAGG
AGTGGCACGACTGCATGGCCACGATGCACACGTTGCTGGTGGAGAACACT
AAGGATCCAAACCTAGAAACCAGCAATGAGGAATATAAAAACTTCTTGAA
GAACTTCGACGAGAGCTTGAACTATGAGAAAAAATTTTGGGCTCACCTCT
GCGAACTGGGCCTAAAGAAGGGCATCGCCGCCTACAAGAACGCTGCACCC
GAGAACTATGGCAGTGCCACGCACCGACAACTACTGGCGGAGGCCACCCT
TGCCTTCGAGGAGGAAGGTCGCGGTCCACAGGCGCAGGCGGCACTGGCGA
AGCTGGCATCCATTTGCCACAAGCACTGGCAGGATGGACGTCAGCAGTGC
GAGCAGCTTAGCCTGCGCTCTCATCCCTGCACACTGCCCAAGAAAGTGCC
ACACGAGAAGCACAACAGCGGAGTGATCCACATCTCCAGCTGCAATTGCG
GTCGCACTCAGGGCCGTCGAGAGGATCCGTTCAACCTGCGGCAAGCGAAC
TACGAGTTCTACGAGCACATTGCTCAAATGTGCAACTTGTGCGTTAAGGT
CAAGCAGTACCAGTTCCCCATTTTCGAGCCATCGGTTAGTGATTACCGGG
CGGCGGCCTTTGAAGCTGCATTTCCTCTGTTGAACAATGGAAAAAGTGGT
GCGCCGCAAGACGAAGATGCGGAGGAGGATGAAGCGGAGGAAGAGGAGGG
TCAGGAGCAAGAGCAACCCACGGAAGAGCAGCTTCAGAATACCGCCAGCA
ACTGCTGCTCCCAGCCCTTGTCGCCCACCTTTGGGTCCGATCTAAACATG
TCCATTGCCGGATTTGGAGCATCACTGAAGGAATCGCAGGCTAGTTCCGA
GCAACTGTTGAATTCCGAGCAGAATACCACAAGCAGTGGCACCTCCAGCG
CCGACACGGATAACGAACTCGTGGTTGAGCTCCAGGAGCCAGCGAAGAAG
GAGGCTCGCGAAGACGCCGGTCCAGCCCATGCCGTTTCCACGTCCACAAC
TGAGTATCTGCCGGGCTTGGTCCACACTGTCAGCAACTTTGGCCTGCTGC
CGCTCTTCCCAAGTTGGTCCCTGGCCTGCGTGGGTCCCAGTTCCATTTAT
AGCCACAATACCGGGCTGCAGGAGCACTTCCAGAGCGGCTTCTTGTCCGG
CGCCAATTTCCTGCTGCCCTGGGACGTCCAGTTGCGTCTAGTTCACGCGC
CCAAGCAGCAATACCAGCAGCAGCATCACGGAAAGAAGCAGCAGCGGTGG
AAGAAGCAGGGCGACAGGCTTTCGCTCAAAATATTCGTCGGCATGGAGTA
CGAGTGCTCCCGCGGACACCGGTTCATGATGTGCGCCCCAGATCGCGTGC
TGCGCGGTGGAGCAGACATCGAACGCGAAACCTGCAGCATGGTAGTCCAC
AACAACATGCCGCTCTATTATCCCTGTCCCTGCCGATCCCAGAACAACTT
TCTGGCGCAGCTGATGCGCATCCATGTGGTGACGCCCAAGGCGCCGGTCA
ACATCATCGTGGATCCCAAGGTGTGCGTGGGAAGGTACACCTTCACCATG
GGCAGCATAGTACCGCCTCGCCTCTCACAGAGCGCCTACTGGATCATCCG
ATTGCCCTACGTCTACCAGGGTGACGATGTGCTCATCGCTCCGCCCGAGC
AACTGGATCCGGGCTATCCGCTGACCGGTGGCTATCTACTGCCTGGGATG
TTCGGAGTGGTGGAGACGGATCCCACACTGGATTTGAATGAACCTGACAA
GATGGGCGCTTCTGCAGCGGGAAATTTCACTAGGATTTAAGAGTCCACAC
AAATGAATACAATAAAAACCATTATGATCCTGTACCTCTTACCAGAGTTC
CACTGTTAGAACAGTGAATAAATCAAAAGCCTTACCCAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

FI05277.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-RA 2997 CG6729-RA 61..2997 1..2937 14610 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10739546..10741299 2937..1184 8755 99.9 Minus
chr2L 23010047 chr2L 10741457..10742534 1136..59 5330 99.6 Minus
chr2L 23010047 chr2L 10742586..10742643 58..1 290 100 Minus
chr2L 23010047 chr2L 10741352..10741398 1183..1137 235 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-RA 2835 CG6729-PA 1..2835 6..2840 14100 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-RA 2993 CG6729-RA 57..2993 1..2937 14610 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-PA 944 CG6729-PA 1..944 6..2837 4408 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10740776..10742535 2943..1184 8785 99.9 Minus
2L 23513712 2L 10742693..10743770 1136..59 5330 99.6 Minus
2L 23513712 2L 10743822..10743879 58..1 290 100 Minus
2L 23513712 2L 10742588..10742634 1183..1137 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10740776..10742535 2943..1184 8785 99.9 Minus
2L 23513712 2L 10742693..10743770 1136..59 5330 99.6 Minus
2L 23513712 2L 10743822..10743879 58..1 290 100 Minus
2L 23513712 2L 10742588..10742634 1183..1137 235 100 Minus
Blast to na_te.dros performed 2014-11-26 20:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6765..6819 2254..2308 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6764 2252..2295 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6861 2254..2316 128 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6785 2254..2295 120 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6827..6891 2244..2308 118 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6834..6889 2254..2309 118 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6858..6913 2254..2309 118 67.9 Plus
roo 9092 roo DM_ROO 9092bp 1046..1105 2251..2309 117 68.3 Plus

FI05277.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:19:26 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10742586..10742643 1..58 100   Minus
chr2L 10741457..10742534 59..1136 99 <- Minus
chr2L 10741352..10741398 1137..1183 100 <- Minus
chr2L 10740776..10741299 1184..1707 99 <- Minus
chr2L 10740230..10740719 1764..2253 100 == Minus
chr2L 10739546..10740173 2310..2937 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:10 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 1..2835 6..2840 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:28 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 1..2835 6..2840 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:54:36 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 1..2835 6..2840 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:12 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 1..2835 6..2840 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:19:26 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 1..2835 6..2840 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:04 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 56..2988 1..2933 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:27 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 56..2988 1..2933 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:54:36 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 57..2993 1..2937 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:52 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 56..2988 1..2933 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:19:26 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 57..2993 1..2937 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:19:26 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10743822..10743879 1..58 100   Minus
2L 10742693..10743770 59..1136 99 <- Minus
2L 10742588..10742634 1137..1183 100 <- Minus
2L 10740782..10742535 1184..2937 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:54:36 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10743822..10743879 1..58 100   Minus
arm_2L 10742693..10743770 59..1136 99 <- Minus
arm_2L 10742588..10742634 1137..1183 100 <- Minus
arm_2L 10740782..10742535 1184..2937 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:54 Download gff for FI05277.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10743822..10743879 1..58 100   Minus
2L 10742693..10743770 59..1136 99 <- Minus
2L 10742588..10742634 1137..1183 100 <- Minus
2L 10740782..10742535 1184..2937 99 <- Minus

FI05277.pep Sequence

Translation from 2 to 2839

> FI05277.pep
KMLDDYYTWTYPDIPENVAQELLQLNGSLVVVGIVGRSDCDQANKMVAFG
MEPPSEHTPKDGQMQCYYKPGTSILLLHFESTYDAEIAGQMIDVCIEDVD
TPFDIDSFFEGIRCRFVRMMLLALHVCHIVVYVETGQTFDPTLITVFQLA
KFAREQHLMQFLPQMLRETPAARMSERTRLCTPRILFLFENFPSDEPKTR
ECVSTYEFQMEDCIYELLRHHNIVTNSSSNSLVALPNNKQFVFFNAHEEL
REDTLMKAVECLNETMYKPDLKEEEEDLEILALAPFDGFVKPFALPVDEK
EWDNQQYKKDHTVWNFLERHVQDALMGCFEAGSFKQHAQQGTFQLLNSKE
WHDCMATMHTLLVENTKDPNLETSNEEYKNFLKNFDESLNYEKKFWAHLC
ELGLKKGIAAYKNAAPENYGSATHRQLLAEATLAFEEEGRGPQAQAALAK
LASICHKHWQDGRQQCEQLSLRSHPCTLPKKVPHEKHNSGVIHISSCNCG
RTQGRREDPFNLRQANYEFYEHIAQMCNLCVKVKQYQFPIFEPSVSDYRA
AAFEAAFPLLNNGKSGAPQDEDAEEDEAEEEEGQEQEQPTEEQLQNTASN
CCSQPLSPTFGSDLNMSIAGFGASLKESQASSEQLLNSEQNTTSSGTSSA
DTDNELVVELQEPAKKEAREDAGPAHAVSTSTTEYLPGLVHTVSNFGLLP
LFPSWSLACVGPSSIYSHNTGLQEHFQSGFLSGANFLLPWDVQLRLVHAP
KQQYQQQHHGKKQQRWKKQGDRLSLKIFVGMEYECSRGHRFMMCAPDRVL
RGGADIERETCSMVVHNNMPLYYPCPCRSQNNFLAQLMRIHVVTPKAPVN
IIVDPKVCVGRYTFTMGSIVPPRLSQSAYWIIRLPYVYQGDDVLIAPPEQ
LDPGYPLTGGYLLPGMFGVVETDPTLDLNEPDKMGASAAGNFTRI*

FI05277.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14070-PA 939 GF14070-PA 1..939 3..945 3728 74.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10361-PA 949 GG10361-PA 1..949 2..945 4212 84.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11308-PA 945 GH11308-PA 6..939 6..945 3123 62.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-PA 944 CG6729-PA 1..944 2..945 5056 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17817-PA 967 GI17817-PA 6..967 6..945 3141 61.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17013-PA 953 GL17013-PA 3..953 3..945 3502 69.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24994-PA 953 GA24994-PA 3..953 3..945 3515 68.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11479-PA 927 GM11479-PA 1..927 2..945 4360 89.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22229-PA 944 GD22229-PA 1..944 2..945 4400 91.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17645-PA 962 GJ17645-PA 5..962 5..945 3164 63.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15451-PA 953 GK15451-PA 1..953 2..945 3042 61.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13372-PA 950 GE13372-PA 1..950 2..945 4232 86 Plus

FI05277.hyp Sequence

Translation from 2 to 2839

> FI05277.hyp
KMLDDYYTWTYPDIPENVAQELLQLNGSLVVVGIVGRSDCDQANKMVAFG
MEPPSEHTPKDGQMQCYYKPGTSILLLHFESTYDAEIAGQMIDVCIEDVD
TPFDIDSFFEGIRCRFVRMMLLALHVCHIVVYVETGQTFDPTLITVFQLA
KFAREQHLMQFLPQMLRETPAARMSERTRLCTPRILFLFENFPSDEPKTR
ECVSTYEFQMEDCIYELLRHHNIVTNSSSNSLVALPNNKQFVFFNAHEEL
REDTLMKAVECLNETMYKPDLKEEEEDLEILALAPFDGFVKPFALPVDEK
EWDNQQYKKDHTVWNFLERHVQDALMGCFEAGSFKQHAQQGTFQLLNSKE
WHDCMATMHTLLVENTKDPNLETSNEEYKNFLKNFDESLNYEKKFWAHLC
ELGLKKGIAAYKNAAPENYGSATHRQLLAEATLAFEEEGRGPQAQAALAK
LASICHKHWQDGRQQCEQLSLRSHPCTLPKKVPHEKHNSGVIHISSCNCG
RTQGRREDPFNLRQANYEFYEHIAQMCNLCVKVKQYQFPIFEPSVSDYRA
AAFEAAFPLLNNGKSGAPQDEDAEEDEAEEEEGQEQEQPTEEQLQNTASN
CCSQPLSPTFGSDLNMSIAGFGASLKESQASSEQLLNSEQNTTSSGTSSA
DTDNELVVELQEPAKKEAREDAGPAHAVSTSTTEYLPGLVHTVSNFGLLP
LFPSWSLACVGPSSIYSHNTGLQEHFQSGFLSGANFLLPWDVQLRLVHAP
KQQYQQQHHGKKQQRWKKQGDRLSLKIFVGMEYECSRGHRFMMCAPDRVL
RGGADIERETCSMVVHNNMPLYYPCPCRSQNNFLAQLMRIHVVTPKAPVN
IIVDPKVCVGRYTFTMGSIVPPRLSQSAYWIIRLPYVYQGDDVLIAPPEQ
LDPGYPLTGGYLLPGMFGVVETDPTLDLNEPDKMGASAAGNFTRI*

FI05277.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-PA 944 CG6729-PA 1..944 2..945 5056 100 Plus