Clone FI05281 Report

Search the DGRC for FI05281

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:81
Vector:pOT2
Associated Gene/TranscriptCG4705-RB
Protein status:FI05281.pep: gold
Sequenced Size:3212

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4705 2008-08-15 Release 5.9 accounting
CG4705 2008-12-18 5.12 accounting

Clone Sequence Records

FI05281.complete Sequence

3212 bp assembled on 2008-07-17

GenBank Submission: BT044210.1

> FI05281.complete
TATCAGTTCAGTTTCTTCGTTTAATTTTTGTTTGTTGCAAAAATGGTTTA
AATTCGCAGTCTTTTGCTTTTTGAGCACTTATTAGAGTAGGACAATATGC
CGCCCACGGAGACACTGCGTCCGGGAGAACGCGGAACAGCCGGTGGACCG
GGAGCAGGAGCACCCGAACAAACGTACATCGTCAGGCAGAGCAACAAATA
CTATGAACACCGAGATTCCCAGGCCACGGCCATGTCGGTTGATTACTCGG
GTCAGTGGGTGCTCCTCGCGGGCCGTGGTCACCTGGCTTTGCAGCGTTTG
GGACAGGACGATGGGTCTCTGCGACGACATGAACGGCAATCGAAGTACGA
GGTGTCCGTAGCAGAGTTTGCCATATGTCCCAGTCGCAAAGAGTACTGCG
CCATAGCGACTAGCCAGCACATAGACATCGTTCGCTGGGGCACTGCGGAA
CCACACTACGAGATGTCCTTGCGTGGGCATACTCGAACAGTGACCGACAT
TGACTGGCACGGCAAGGATCCGAATCTGCTGGTCAGCTGCTCAATAGACA
CATTTTCTCATATTTGGGACTTAAGGGAGCCCAGGAAACCAGCCCTGTCC
TTGAATGCCGTGTGCATGTCTGGTGCTACACAAGTGGGATTCAACCGCGT
TTCGGGCAACCTTTTGGCTGCTGCCCATGATGGAGATTTACGCATCTGGG
ATATTCGCAAGGGTAGTTGCCCGACGCACTATATCACAGCACATTTAAAT
AGAGTGCATGGCATCAATTGGAGCCACAAAAGGGAGACCTGCTTGGCAAC
CGCCAGTCAGGATGGAACGGTCAAGTACTTTGATGTATGTAATCCTCGCA
GGGCCGAGAAGATCATTACAACCATGTCGCCCGTTTGGAGAGCGAGATAC
ACGCCTATTGGCAACGGTCTGGTTAGCATTGTGGTGCCCCATTTGGGACG
CGGAGAGAATAGTTTGCTGCTCTGGAGCAACAGCAAGCAAACGGACCCTA
TTTGTTCCTTCGTGGGGCACACCGATGTCATTCTTGACTTTGCCTGGCGT
CCAAATCGTGAAAGTTCCAATGAAATAGAACTGGTCACTTGGTCCAGGGA
TCGCACGCTGCGGGTGTGGAAGATCGATGATAATATGCTAAAGCTTTGCG
AACCGTCTGCGGAAGAAATAGAATCCCGTTTCGAGCCCGATCTCAGTGAG
TTAAGAGTGCCTACTCCTCCAGAATTCCTGCATCCACGATCAATTTTGGT
TGCCGCTTCGTTGCCCATATCCACGGGTGACGGTGCTTGTAATACCTTGC
CCATGGCTCGCTCCCCGAGCTTTGGAGGTGGCTACTATCGCAGGGAAGAG
CCCCACATAGCCAGATCACTAACAGATCAACCCACGTGTTCGCTGCACCA
CGAATTCTCGCTGCTCAACACAAACATGCCTCATGTGGAGGTAGACACAC
TAGATGCCATAAAGCGGTACGCCTGCTTCAAGATTTGCGCCGGTGGACAC
ACGGTTATTTTACAAGTGACTTTCACGACATCGTATCCAAGTCCTAGTGC
TCCGCCGGACTTTCAGCTTTGCCAGGGAACCACTCTGTCCAGTGAAGTTA
GTGGAGTTCTGCTAAAAGTGCTCCGTTGCAATGCATTGCAACGGGTCAAG
AAATCCCGCACGTGCCTGGAACAATGCCTACGTGCTCTAGTGGCGGCTAT
GAAGAAAAAGGTGGCCGCTGTAGGCGGAGCGGATCGTAGCCAACTGCTCC
TGCAATCCCCTCGGCTGGAAGGAGCTTTGTCGAGCACCCTGCACGATGCC
TGCATTCCATATCCGCGGACGTCAGGGGTCCATTTCAATGCCATTGGTAT
GCTGACCACTTTCGCCCAACCAGTGAACAACAAAAGGCTGACCCTGCGGC
AACACACCGCATTGACTCCACGGACTTTTTCATCGATTAATGGTAGTGGA
TTGCTAGGCAATGTGATGGCCACCGCCCAGAGGGAAGCTAACGCCTCCTT
TTACCTCCAGGAGAGGATGATTTCGGGAAAACCGGGCAAGCAGCGAGCCA
TCCGACAGATGAATGGAAGTCCGGTGGTTCACGTATACGACACAAGTAGC
TTACTCCACATTAGTCGGAGAATGGCTCGGGAGTTCTCCCTCGATAAGTG
CAACATAGCAGAAACGTGTCGTAAAAATGGTGAGATCTGTCGCCAGCATG
GGCGCTTGGACTTGGTGCCCGTGTGGCTATTGGCGGAACTGATAGCCACA
CCCCAAATTCCACATGAAACACTCAACGATCTGCTGTTCTACAAAGATCC
CTTCAAGAAATCTCTGCTGGAATCACTAATAATGCATTATGCTATCTCCG
GTGACATACAGACTGCTGTGCTGCTGGCTTGTTTGTTTGACAAGTGCCCC
ACGGGTGGCGGTGCCATTATGGAGAAGACAGTTCGACTTCCGCCGCAGCT
TAACTCGCAAATTTCACCGTATCACACGGTCCTGCCGCTTGACGTCAAGT
CATCTTCTTCATCGAACACTTGGCAGCAACTTAAGCAACTACGCAGCAAC
TCTTGGTCCGACTCCCTGGATTTGGAGATTAAGCAAATCCAGTCTGATGC
ATACGCTTGCTCATTGATTAGACGGACTAAGATGCCACTGTTTGATCAAT
TTAAGCGCGCCTATGCCGAAATTTTATTTGGCTGGCAGTTGCTTTCGAAG
CGGGCTTTGATCCTCAAGCACACGCAGAATACACCACCTCCAGTCCAGGG
TGTGGAATTCGTTACCGAGTGCAGGAAGTGTGCCAAGCCCAAACGGACGC
CCAAATGCGAGCCCTGCAAGCGACCCGTACTCTTCTGCGTCCTCTGCCGT
TTGCCTGTGAAAGGAGCAGCCAATGCGTGTCTGGCTTGTGGCCATGGCGG
TCACATTGATCACATGATGCAGTGGTTTGAGAAACACAATGTCTGTGCTA
CGTGTGGCTGCAAGTGCTTGGAGCGCACCTCAGAGCTGCTAGCCCTACTC
AGCTGATTCAGACCTTGAGTGATGTGCATTCCTTTCAAAAATAATCTTAC
TTAACTTTCTTTCGTCTGTGTGGATATCAAAATAGTTAGGTGTTTTTTAG
TCATTAGGCCAACAATTTTTGTACGATTTGCATACCATTGAGAAATATAT
GACCACTTACTAGCCAAGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

FI05281.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-RB 3384 CG4705-RB 113..3284 1..3172 15860 100 Plus
CG4705-RC 3205 CG4705-RC 1113..3205 1078..3170 10465 100 Plus
CG4705-RC 3205 CG4705-RC 26..1102 1..1077 5385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11091536..11093389 1078..2931 9270 100 Plus
chr2L 23010047 chr2L 11090225..11090632 1..408 2040 100 Plus
chr2L 23010047 chr2L 11090963..11091246 620..903 1420 100 Plus
chr2L 23010047 chr2L 11093511..11093755 2926..3170 1210 99.6 Plus
chr2L 23010047 chr2L 11090695..11090906 408..619 1060 100 Plus
chr2L 23010047 chr2L 11091306..11091481 903..1078 880 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-RD 2910 CG4705-PD 1..2910 97..3006 14550 100 Plus
CG4705-RB 2910 CG4705-PB 1..2910 97..3006 14550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-RD 3292 CG4705-RD 28..3197 1..3170 15850 100 Plus
CG4705-RB 3197 CG4705-RB 28..3197 1..3170 15850 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-PD 969 CG4705-PD 1..969 97..3003 4957 100 Plus
CG4705-PB 969 CG4705-PB 1..969 97..3003 4957 100 Plus
CG7609-PB 776 CG7609-PB 18..311 214..1110 184 24.3 Plus
CG7609-PC 777 CG7609-PC 18..311 214..1110 184 24.3 Plus
CG10931-PA 345 CG10931-PA 83..303 436..1140 167 25 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11092782..11094635 1078..2931 9270 100 Plus
2L 23513712 2L 11091471..11091878 1..408 2040 100 Plus
2L 23513712 2L 11092209..11092492 620..903 1420 100 Plus
2L 23513712 2L 11094757..11095003 2926..3172 1220 99.6 Plus
2L 23513712 2L 11091941..11092152 408..619 1060 100 Plus
2L 23513712 2L 11092552..11092727 903..1078 880 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11092782..11094635 1078..2931 9270 100 Plus
2L 23513712 2L 11091471..11091878 1..408 2040 100 Plus
2L 23513712 2L 11092209..11092492 620..903 1420 100 Plus
2L 23513712 2L 11094757..11095003 2926..3172 1220 99.5 Plus
2L 23513712 2L 11091941..11092152 408..619 1060 100 Plus
2L 23513712 2L 11092552..11092727 903..1078 880 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:33:09 has no hits.

FI05281.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:38:33 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11093517..11093755 2932..3170 100   Plus
chr2L 11091536..11093389 1078..2931 100 -> Plus
chr2L 11091307..11091480 904..1077 100 -> Plus
chr2L 11090963..11091246 620..903 100 -> Plus
chr2L 11090696..11090906 409..619 100 -> Plus
chr2L 11090225..11090632 1..408 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:13 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 1..2910 97..3006 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:23 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 1..2910 97..3006 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:21 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 1..2910 97..3006 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:48 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 1..2910 97..3006 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:33 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 1..2910 97..3006 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:48 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 26..3195 1..3170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:23 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 30..3199 1..3170 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:21 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 28..3197 1..3170 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:48 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 26..3195 1..3170 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:33 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 28..3197 1..3170 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:33 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11094763..11095001 2932..3170 100   Plus
2L 11092782..11094635 1078..2931 100 -> Plus
2L 11092553..11092726 904..1077 100 -> Plus
2L 11092209..11092492 620..903 100 -> Plus
2L 11091942..11092152 409..619 100 -> Plus
2L 11091471..11091878 1..408 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:21 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11094763..11095001 2932..3170 100   Plus
arm_2L 11092782..11094635 1078..2931 100 -> Plus
arm_2L 11092553..11092726 904..1077 100 -> Plus
arm_2L 11092209..11092492 620..903 100 -> Plus
arm_2L 11091942..11092152 409..619 100 -> Plus
arm_2L 11091471..11091878 1..408 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:21 Download gff for FI05281.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11094763..11095001 2932..3170 100   Plus
2L 11092782..11094635 1078..2931 100 -> Plus
2L 11092553..11092726 904..1077 100 -> Plus
2L 11092209..11092492 620..903 100 -> Plus
2L 11091942..11092152 409..619 100 -> Plus
2L 11091471..11091878 1..408 100 -> Plus

FI05281.pep Sequence

Translation from 96 to 3005

> FI05281.pep
MPPTETLRPGERGTAGGPGAGAPEQTYIVRQSNKYYEHRDSQATAMSVDY
SGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEY
CAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSI
DTFSHIWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRI
WDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNP
RRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD
PICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNMLKL
CEPSAEEIESRFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNT
LPMARSPSFGGGYYRREEPHIARSLTDQPTCSLHHEFSLLNTNMPHVEVD
TLDAIKRYACFKICAGGHTVILQVTFTTSYPSPSAPPDFQLCQGTTLSSE
VSGVLLKVLRCNALQRVKKSRTCLEQCLRALVAAMKKKVAAVGGADRSQL
LLQSPRLEGALSSTLHDACIPYPRTSGVHFNAIGMLTTFAQPVNNKRLTL
RQHTALTPRTFSSINGSGLLGNVMATAQREANASFYLQERMISGKPGKQR
AIRQMNGSPVVHVYDTSSLLHISRRMAREFSLDKCNIAETCRKNGEICRQ
HGRLDLVPVWLLAELIATPQIPHETLNDLLFYKDPFKKSLLESLIMHYAI
SGDIQTAVLLACLFDKCPTGGGAIMEKTVRLPPQLNSQISPYHTVLPLDV
KSSSSSNTWQQLKQLRSNSWSDSLDLEIKQIQSDAYACSLIRRTKMPLFD
QFKRAYAEILFGWQLLSKRALILKHTQNTPPPVQGVEFVTECRKCAKPKR
TPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGHIDHMMQWFEKHNVC
ATCGCKCLERTSELLALLS*

FI05281.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15640-PA 1001 GF15640-PA 67..1001 25..969 4543 89.8 Plus
Dana\GF22867-PA 778 GF22867-PA 18..312 40..338 168 23.9 Plus
Dana\GF11355-PA 430 GF11355-PA 174..428 122..361 157 24.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23705-PA 969 GG23705-PA 1..969 1..969 5043 97.5 Plus
Dere\GG12005-PA 777 GG12005-PA 18..311 40..338 173 24.3 Plus
Dere\GG16897-PA 430 GG16897-PA 174..428 122..361 157 24.8 Plus
Dere\GG21819-PA 343 GG21819-PA 71..297 103..343 154 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10306-PA 997 GH10306-PA 1..997 1..969 4240 81.6 Plus
Dgri\GH10305-PA 451 GH10305-PA 1..451 1..456 1712 74.6 Plus
Dgri\GH13986-PA 784 GH13986-PA 113..321 128..345 165 26.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-PD 969 CG4705-PD 1..969 1..969 5156 100 Plus
CG4705-PB 969 CG4705-PB 1..969 1..969 5156 100 Plus
CG7609-PB 776 CG7609-PB 18..311 40..338 184 24.3 Plus
CG7609-PC 777 CG7609-PC 18..311 40..338 184 24.3 Plus
CG10931-PA 345 CG10931-PA 83..303 114..348 167 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17068-PA 977 GI17068-PA 1..977 1..969 4116 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19541-PA 964 GL19541-PA 1..964 1..969 4494 85.6 Plus
Dper\GL21279-PA 422 GL21279-PA 166..420 122..361 165 24.3 Plus
Dper\GL13576-PA 772 GL13576-PA 104..312 128..345 164 27.2 Plus
Dper\GL21757-PA 442 GL21757-PA 186..437 122..358 163 25.9 Plus
Dper\GL12106-PA 430 GL12106-PA 174..428 122..361 162 24.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18371-PA 986 GA18371-PA 1..986 1..969 4679 88.4 Plus
Dpse\GA26389-PB 440 GA26389-PB 184..435 122..358 175 25.4 Plus
Dpse\GA20478-PA 772 GA20478-PA 104..312 128..345 164 27.2 Plus
Dpse\GA11814-PA 456 GA11814-PA 265..400 125..256 159 26.5 Plus
Dpse\GA18051-PA 430 GA18051-PA 174..428 122..361 157 24.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18873-PA 483 GM18873-PA 1..483 1..483 2616 99.8 Plus
Dsec\GM18885-PA 443 GM18885-PA 5..443 531..969 2296 97 Plus
Dsec\GM12225-PA 777 GM12225-PA 18..311 40..338 173 24.3 Plus
Dsec\GM21820-PA 353 GM21820-PA 71..297 103..343 158 24.7 Plus
Dsec\GM24205-PA 430 GM24205-PA 174..428 122..361 156 25.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23761-PA 967 GD23761-PA 1..967 1..969 5177 99 Plus
Dsim\GD17676-PA 378 GD17676-PA 18..311 40..338 163 24.3 Plus
Dsim\GD11312-PA 353 GD11312-PA 71..297 103..343 161 25.1 Plus
Dsim\GD18995-PA 430 GD18995-PA 174..428 122..361 156 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10542-PA 989 GJ10542-PA 1..989 1..969 4214 81.2 Plus
Dvir\GJ10519-PA 783 GJ10519-PA 20..297 40..318 158 23.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18363-PA 974 GK18363-PA 1..974 1..969 4395 85 Plus
Dwil\GK22272-PA 309 GK22272-PA 1..309 655..969 1289 77.6 Plus
Dwil\GK22293-PA 159 GK22293-PA 1..159 1..160 747 88.1 Plus
Dwil\GK14487-PA 429 GK14487-PA 173..427 122..361 156 24.8 Plus
Dwil\GK23014-PA 457 GK23014-PA 266..400 125..255 155 27.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18512-PA 969 GE18512-PA 1..969 1..969 5079 97.8 Plus
Dyak\GE10431-PA 777 GE10431-PA 18..311 40..338 173 24.3 Plus
Dyak\GE11895-PA 343 GE11895-PA 82..307 114..351 169 26.5 Plus
Dyak\GE24278-PA 430 GE24278-PA 174..428 122..361 157 24.8 Plus

FI05281.hyp Sequence

Translation from 96 to 3005

> FI05281.hyp
MPPTETLRPGERGTAGGPGAGAPEQTYIVRQSNKYYEHRDSQATAMSVDY
SGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEY
CAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSI
DTFSHIWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRI
WDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNP
RRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD
PICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNMLKL
CEPSAEEIESRFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNT
LPMARSPSFGGGYYRREEPHIARSLTDQPTCSLHHEFSLLNTNMPHVEVD
TLDAIKRYACFKICAGGHTVILQVTFTTSYPSPSAPPDFQLCQGTTLSSE
VSGVLLKVLRCNALQRVKKSRTCLEQCLRALVAAMKKKVAAVGGADRSQL
LLQSPRLEGALSSTLHDACIPYPRTSGVHFNAIGMLTTFAQPVNNKRLTL
RQHTALTPRTFSSINGSGLLGNVMATAQREANASFYLQERMISGKPGKQR
AIRQMNGSPVVHVYDTSSLLHISRRMAREFSLDKCNIAETCRKNGEICRQ
HGRLDLVPVWLLAELIATPQIPHETLNDLLFYKDPFKKSLLESLIMHYAI
SGDIQTAVLLACLFDKCPTGGGAIMEKTVRLPPQLNSQISPYHTVLPLDV
KSSSSSNTWQQLKQLRSNSWSDSLDLEIKQIQSDAYACSLIRRTKMPLFD
QFKRAYAEILFGWQLLSKRALILKHTQNTPPPVQGVEFVTECRKCAKPKR
TPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGHIDHMMQWFEKHNVC
ATCGCKCLERTSELLALLS*

FI05281.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-PD 969 CG4705-PD 1..969 1..969 5156 100 Plus
CG4705-PB 969 CG4705-PB 1..969 1..969 5156 100 Plus
CG7609-PB 776 CG7609-PB 18..311 40..338 184 24.3 Plus
CG7609-PC 777 CG7609-PC 18..311 40..338 184 24.3 Plus
CG10931-PA 345 CG10931-PA 83..303 114..348 167 25 Plus