Clone FI05285 Report

Search the DGRC for FI05285

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:85
Vector:pOT2
Associated Gene/TranscriptAtpalpha-RD
Protein status:FI05285.pep: gold
Sequenced Size:5088

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Atpalpha 2008-08-15 Release 5.9 accounting
Atpalpha 2008-12-18 5.12 accounting

Clone Sequence Records

FI05285.complete Sequence

5088 bp assembled on 2008-07-17

GenBank Submission: BT044212.1

> FI05285.complete
CCGAACTGGGAAGGTCCAACTGTGACAGCAGCAGCTATCTCGTCTCTTTG
TCGGGTGGTACAGTACAGCTCTGCTCCCCTGCCGCCCGCCCGCCCCCTCG
GCGCTGGTGTGTGCCCGCTGCTCTGCTTACACAATAACTGTGCATCGATT
GAGTCCAGCTCCAGCGAGAAGAGAAGCAGCCCAGGACTAACTCTCGTTCG
ACATAAGAATAAAAGGATATTACGTTAGCGTACAGCAGTCGTGTGTGATC
AGTATTTGTTGTATTTGTCTCGTTCCAACGCGAATCGGTTCTAGTGCTGA
AAACAAGTTCAATACTGCTAACGGGGTAGTTTTCTGCGAAAGCCCCCAAA
ACACAATACGCAACGCCAAGCGCAAAAATTGTGTAATAGCACCCAAACGT
GTAAAAGATTGTTTAGCACTTGAGAGGGAATCTTAGAACGAGGGAAACCA
GCGACGCGAGATAAAAGATACGAAAGCAGATCGATAGTCGTTTGAACACT
TGCCACATCAAGACGCAAGATGCCGGCCAAAGTTAATAAAAAGGAGAATT
TAGATGATCTCAAACAGGAGTTGGATATCGATTTTCATAAAATCTCTCCT
GAGGAATTGTATCAGCGCTTTCAGACACATCCCGAAAATGGTCTAAGTCA
CGCCAAGGCCAAGGAAAACTTGGAGCGCGATGGTCCCAATGCGCTGACGC
CACCCAAGCAGACGCCCGAATGGGTGAAGTTCTGTAAGAACCTGTTCGGT
GGCTTCGCCATGTTGCTGTGGATCGGTGCTATTCTCTGCTTTGTGGCCTA
TTCTATCCAGGCCAGCACCAGCGAGGAGCCGGCCGACGATAATTTGTATC
TGGGTATTGTACTTTCCGCTGTCGTCATCGTGACGGGCATTTTCTCATAC
TATCAGGAATCGAAAAGTTCTAAGATCATGGAATCGTTCAAGAACATGGT
ACCCCAGTTCGCCACCGTCATCCGCGAGGGCGAGAAACTCACGCTGCGCG
CTGAGGATCTCGTTCTGGGCGATGTCGTTGAGGTGAAGTTCGGCGACCGT
ATCCCCGCTGATATCCGCATCATCGAGGCGCGCAACTTCAAGGTGGACAA
CTCCTCGCTGACCGGCGAGTCGGAGCCGCAGTCCCGCGGTGCCGAGTTCA
CCCATGAGAATCCGCTGGAGACCAAGAATCTGGCCTTCTTCTCCACCAAC
GCCGTCGAGGGCACTGCCAAGGGTGTGGTCATCAGCTGTGGCGATCACAC
CGTCATGGGCCGCATTGCTGGCCTTGCCTCCGGTCTAGACACCGGCGAGA
CGCCCATTGCCAAGGAGATCCACCATTTCATCCACCTTATTACCGGCGTG
GCCGTGTTCCTGGGCGTCACCTTCTTCGTGATTGCCTTCATCCTGGGCTA
CCACTGGCTGGACGCTGTCATCTTTTTGATCGGTATCATCGTCGCCAACG
TGCCCGAGGGTCTGCTGGCCACCGTAACTGTGTGCCTGACCCTTACCGCC
AAGCGTATGGCCTCAAAGAACTGTCTGGTGAAGAATCTGGAGGCCGTGGA
GACCCTTGGCTCCACATCGACCATCTGCTCCGATAAGACCGGCACCCTCA
CCCAGAACCGAATGACGGTCGCCCACATGTGGTTCGATAATCAGATCATC
GAGGCCGACACAACTGAGGATCAGTCGGGTGTTCAATACGATAGAACCAG
CCCTGGATTCAAGGCGCTCTCTCGCATTGCCACTCTCTGTAACCGTGCCG
AGTTCAAGGGAGGCCAAGATGGCGTCCCAATCCTCAAGAAAGAAGTCAGT
GGAGATGCCTCCGAGGCTGCTCTGCTCAAGTGCATGGAACTGGCTCTGGG
CGATGTGATGAACATTCGCAAGCGTAATAAGAAGATTGCCGAGGTGCCCT
TCAACTCCACCAACAAATACCAAGTGTCCATCCACGAAACCGAGGATACC
AACGATCCCCGCTACTTGCTCGTAATGAAGGGAGCCCCCGAACGTATCTT
GGAGCGCTGCTCTACCATTTTTATCAACGGCAAGGAGAAGGTTCTGGACG
AGGAGATGAAGGAGGCGTTCAACAATGCCTACATGGAACTCGGTGGACTG
GGTGAGCGCGTGCTCGGTTTCTGTGACTTTATGCTGCCATCCGACAAGTA
TCCCAACGGCTTTAAGTTCAACACCGACGACATCAACTTCCCCATCGATA
ATCTGCGTTTCGTCGGCCTTATGTCCATGATTGATCCCCCACGTGCTGCC
GTGCCCGATGCCGTTGCCAAGTGCCGATCGGCCGGCATCAAGGTCATCAT
GGTCACCGGCGATCACCCGATCACTGCCAAGGCCATCGCCAAGTCTGTCG
GTATTATATCCGAGGGCAACGAGACCGTCGAGGACATTGCCCAGCGCCTC
AACATACCCGTCTCTGAAGTGAATCCCCGCGAGGCCAAGGCCGCCGTCGT
CCATGGCGCTGAGCTTCGTGATGTGTCCAGCGACCAGCTGGATGAAATCC
TCCGCTACCACACCGAGATCGTCTTCGCCCGTACCTCGCCCCAGCAGAAA
TTGATCATTGTCGAGGGTTGCCAGCGCATGGGAGCTATTGTGGCCGTGAC
TGGTGATGGTGTCAACGATTCTCCCGCTCTGAAGAAAGCCGATATCGGTG
TTGCCATGGGTATAGCCGGTTCCGATGTGTCCAAGCAGGCTGCTGACATG
ATTTTGCTGGACGACAACTTTGCCTCCATTGTGACTGGTGTGGAGGAGGG
TCGCCTGATCTTCGACAACCTGAAAAAGTCCATCGCCTACACCCTGACCT
CCAACATTCCCGAAATCTCGCCCTTCCTGGCCTTCATCCTCTGCGATATA
CCACTGCCACTGGGAACCGTGACGATTCTTTGCATCGATCTGGGCACTGA
CATGGTAAGTTTAGACCTCTGCCCCAAACCCAAGCTCCATCGAAGATTAA
AGTTAAAGTTGCTATTAAGTCAGTATCATTCGAGCAAGTTATATAGTTAT
ACAAGTTGTAGCCCATCCCAGTTAATAGTTAAGAACTAGCCTTTTTAACA
CCAACTCTGAACGTAAATTGTGCGGCTGACTGCACTGCCGATCAGATTCC
TGCCATATCACTGGCCTACGAGGGACCCGAGGCTGACATCATGAAGCGCC
GGCCGCGCAATCCGGAGATCGATAACCTAGTCAACGAGAGGTTGATTTCG
ATGGCCTACGGACAGATCGGCATGATCCAGGCCGCCGCCGGCTTCTTTGT
GTACTTCGTCATCATGGCTGAGAACGGCTTCTTGCCCAAGAAACTGTTTG
GCATTCGTAAGATGTGGGACTCAAAGGCTGTTAACGATCTAACTGATTCC
TACGGTCAAGAATGGACCTACCGCGACCGCAAGACCTTGGAGTATACCTG
CCACACGGCCTTCTTCATCTCGATCGTGGTTGTGCAATGGGCCGATCTGA
TCATCTGCAAGACGCGTCGTAACTCGATCTTCCAGCAGGGCATGCGCAAC
TGGGCTTTGAACTTTGGCCTCGTCTTTGAAACCGTGCTGGCCGCGTTCCT
CTCATACTGCCCGGGCATGGAGAAGGGTCTGCGCATGTACCCCCTGAAAC
TCGTCTGGTGGTTCCCGGCTATTCCATTTGCGCTGGCCATCTTCATCTAT
GACGAGACCCGTCGTTTCTACTTGCGCCGCAACCCCGGAGGCTGGTTGGA
GCAGGAGACCTACTATTAAACACCCACACTGCTACACTCCCACACACACA
GCCACATGCCCACACACGAATGCACACCACAACAAGAGCAACCAGGAACA
CCCGCAAACAACACCTACAAACCATGGAGAGCAACAAATAGAAATGTTTA
TGAACCACAAAACCCACAAAAGCAACACAACCACAGTAATAGCAACAGCA
GCAGCAACGGCAACAACAACAGCAACAGCTACGTCTACAACAAGCTACAG
CAAGAACATATTACAATATATTTTATTTTTTTAATTTAATTATTTAAAGT
AAACGAGGATAAACAAAAATGCAAGCGATAATTATTTTAAACGTTAAGTA
AATTTAAATTATAAATTAAAGCTAAAAATAAGATTTAAATAAAGTATAAA
TGAAAATAAAACAAACAACAAAAACGAACAACAATTTCGATGAAACACCA
ATCACATCCAGACAAGAACAACAACAAAATCAACCAGTAACTAAGCAAAA
CAGTAACAAGAACATGTTTTTAGTAAAATTATTAACGTAACGAGAACTGG
ATGAGGCGATTTTTATCGCCACAATAACAAGATCCCAGAAAGCTAACACA
CACACACGCACTCACAAACACACTCACAAATACACACACACACACACCGA
TACACAACGCATGACGAGACAAAGTATATAAGAAGTTTAGAGAAATTATA
AAACGAAGTAAATAAAAAGTAAAATGAGGAAAGAAAACAATGAAAACCCC
TAGCGTAGTTACCAAGTAAGCCGTGAAAAGTAAAGCCCAATAAAAACCAC
AACAACAACAACCAAAACAAAAGAACAGAAATTAATTTGCAAAACTTGAA
ACTTGTGTGTGTAAACGCAGCTTAGCGCAGAAGAACGAAATATATATATA
AACAGAAGAAAAACCACAAGAAATGTGAACACGACGAATATAATTGTTTA
TATATATACACACATATATTATATGGAAAAAATTTGATTATATAAATGGA
GCTATACAACAATACACCAAAAACCAAAATTGAAACCATAACGAAATCGA
CCGATCTGCACTTGGCACTACGCCGAGTTCCGGATAAAGGTCTCCGAGCA
ATGTTTGGAGACCTGCCGGTCTAGAATTTGTTAAAATCTAATGAAAAAAC
CAACTAAATGTTTAATAATAAACCCCCTTAAACCAATTGACATGCAATAT
TATGCTTTGTGTGCATTTAAGCCCAAAAGAACCGATGCCGAGATTCGGTG
GGATTAAGTCCCCCGATGTCGATATCGAGATTCAGATACAGATACCATTA
CCGATACCTAGGCCCAGAAGGAAAAGATAAAACCAAATAAAACTAAAAAC
CAAATTCAATACGAAACAAAAAAAAAAAAAAAAAAAAA

FI05285.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-RD 5088 Atpalpha-RD 1..5088 1..5088 25380 99.9 Plus
Atpalpha.aj 5664 Atpalpha.aj 663..3061 508..2906 11995 100 Plus
Atpalpha.u 5989 Atpalpha.u 663..3061 508..2906 11995 100 Plus
Atpalpha.aj 5664 Atpalpha.aj 3135..5052 3171..5088 9485 99.6 Plus
Atpalpha.u 5989 Atpalpha.u 3135..5052 3171..5088 9485 99.6 Plus
Atpalpha.aj 5664 Atpalpha.aj 31..437 1..407 2035 100 Plus
Atpalpha.u 5989 Atpalpha.u 31..437 1..407 2035 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16788157..16789942 904..2689 8885 99.8 Plus
chr3R 27901430 chr3R 16797687..16799155 3599..5067 7270 99.7 Plus
chr3R 27901430 chr3R 16790289..16790794 2687..3192 2515 99.8 Plus
chr3R 27901430 chr3R 16781671..16782077 1..407 2035 100 Plus
chr3R 27901430 chr3R 16787829..16788096 640..907 1340 100 Plus
chr3R 27901430 chr3R 16797381..16797614 3365..3598 1155 99.6 Plus
chr3R 27901430 chr3R 16797063..16797239 3189..3365 885 100 Plus
chr3R 27901430 chr3R 16787627..16787759 508..640 665 100 Plus
chr3R 27901430 chr3R 16784634..16784735 406..507 510 100 Plus
chrU 10048995 chrU 5510215..5510507 2524..2816 340 74.4 Plus
chr4 1351717 chr4 24065..24294 2587..2816 325 76.1 Plus
chrU 10048995 chrU 5509189..5509338 1489..1638 225 76.7 Plus
chr2R 21145070 chr2R 19817499..19817585 1630..1544 195 81.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-RD 2520 CG5670-PD 1..2520 520..3039 12600 100 Plus
Atpalpha-RA 3126 CG5670-PA 106..2504 508..2906 11995 100 Plus
Atpalpha-RK 3009 CG5670-PK 1..2387 520..2906 11935 100 Plus
Atpalpha-RA 3126 CG5670-PA 2509..3126 3102..3719 2670 95.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-RD 5099 CG5670-RD 28..5094 1..5067 25335 100 Plus
Atpalpha-RK 3721 CG5670-RK 193..2693 406..2906 12505 100 Plus
Atpalpha-RJ 5545 CG5670-RJ 115..2615 406..2906 12505 100 Plus
Atpalpha-RK 3721 CG5670-RK 2698..3721 3102..4125 4700 97.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-PD 839 CG5670-PD 1..839 520..3036 4011 100 Plus
Atpalpha-PA 1041 CG5670-PA 36..835 508..2907 3938 100 Plus
Atpalpha-PK 1002 CG5670-PK 1..796 520..2907 3919 100 Plus
Atpalpha-PJ 1002 CG5670-PJ 1..796 520..2907 3919 100 Plus
Atpalpha-PH 1002 CG5670-PH 1..796 520..2907 3919 100 Plus
Atpalpha-PA 1041 CG5670-PA 822..1038 3054..3707 1049 91.3 Plus
Atpalpha-PK 1002 CG5670-PK 783..999 3054..3707 1049 91.3 Plus
Atpalpha-PJ 1002 CG5670-PJ 783..999 3054..3707 1049 91.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20964255..20966040 904..2689 8930 100 Plus
3R 32079331 3R 20973811..20975300 3599..5088 7390 99.7 Plus
3R 32079331 3R 20966396..20966901 2687..3192 2530 100 Plus
3R 32079331 3R 20957761..20958167 1..407 2035 100 Plus
3R 32079331 3R 20963927..20964194 640..907 1340 100 Plus
3R 32079331 3R 20973505..20973738 3365..3598 1170 100 Plus
3R 32079331 3R 20973171..20973347 3189..3365 885 100 Plus
3R 32079331 3R 20963725..20963857 508..640 665 100 Plus
3R 32079331 3R 20960724..20960825 406..507 510 100 Plus
4 1348131 4 3376..3668 2524..2816 340 74.4 Plus
4 1348131 4 2350..2499 1489..1638 225 76.7 Plus
2R 25286936 2R 23931450..23931536 1630..1544 195 81.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20705086..20706871 904..2689 8930 100 Plus
3R 31820162 3R 20714642..20716131 3599..5088 7390 99.7 Plus
3R 31820162 3R 20707227..20707732 2687..3192 2530 100 Plus
3R 31820162 3R 20698592..20698998 1..407 2035 100 Plus
3R 31820162 3R 20704758..20705025 640..907 1340 100 Plus
3R 31820162 3R 20714336..20714569 3365..3598 1170 100 Plus
3R 31820162 3R 20714002..20714178 3189..3365 885 100 Plus
3R 31820162 3R 20704556..20704688 508..640 665 100 Plus
3R 31820162 3R 20701555..20701656 406..507 510 100 Plus
4 1331231 4 3439..3668 2587..2816 325 76 Plus
4 1331231 4 2350..2499 1489..1638 225 76.6 Plus
2R 25260384 2R 23932649..23932735 1630..1544 195 81.6 Minus
2R 25260384 2R 23931586..23931649 2660..2597 185 85.9 Minus
Blast to na_te.dros performed 2014-11-26 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6705..6913 4492..4697 165 57.5 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 1060..1114 586..643 130 72.4 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 398..545 643..496 128 59.7 Minus

FI05285.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:38:27 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16798436..16799109 4348..5021 99 <- Plus
chr3R 16798303..16798383 4215..4295 100 == Plus
chr3R 16798032..16798150 3944..4062 71 == Plus
chr3R 16797687..16797953 3599..3865 99 == Plus
chr3R 16797382..16797614 3366..3598 99 -> Plus
chr3R 16797065..16797239 3191..3365 100 -> Plus
chr3R 16790291..16790792 2689..3190 99 -> Plus
chr3R 16788160..16789941 907..2688 99 -> Plus
chr3R 16787829..16788095 640..906 100 -> Plus
chr3R 16787627..16787758 508..639 100 -> Plus
chr3R 16784636..16784735 408..507 100 -> Plus
chr3R 16781671..16782070 1..407 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:50:48 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RA 102..2504 504..2906 99 == Plus
Atpalpha-RA 2596..3126 3189..3719 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:46 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RA 2596..3126 3189..3719 100   Plus
Atpalpha-RA 102..2504 504..2906 99 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:15 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 1..2520 520..3039 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:09 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RA 2596..3126 3189..3719 100   Plus
Atpalpha-RA 102..2504 504..2906 99 == Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:27 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 1..2520 520..3039 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:50:48 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 1..5067 1..5067 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:45 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 1..5067 1..5067 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:15 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 28..5094 1..5067 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:10 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 1..5067 1..5067 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:27 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 28..5094 1..5067 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:27 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20973811..20975279 3599..5067 100   Plus
3R 20973506..20973738 3366..3598 100 -> Plus
3R 20973173..20973347 3191..3365 100 -> Plus
3R 20966398..20966899 2689..3190 100 -> Plus
3R 20964258..20966039 907..2688 100 -> Plus
3R 20963927..20964193 640..906 100 -> Plus
3R 20963725..20963856 508..639 100 -> Plus
3R 20960726..20960825 408..507 100 -> Plus
3R 20957761..20958167 1..407 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:15 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16799533..16801001 3599..5067 100   Plus
arm_3R 16799228..16799460 3366..3598 100 -> Plus
arm_3R 16798895..16799069 3191..3365 100 -> Plus
arm_3R 16792120..16792621 2689..3190 100 -> Plus
arm_3R 16789980..16791761 907..2688 100 -> Plus
arm_3R 16789649..16789915 640..906 100 -> Plus
arm_3R 16789447..16789578 508..639 100 -> Plus
arm_3R 16786448..16786547 408..507 100 -> Plus
arm_3R 16783483..16783889 1..407 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:33 Download gff for FI05285.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20714642..20716110 3599..5067 100   Plus
3R 20714337..20714569 3366..3598 100 -> Plus
3R 20714004..20714178 3191..3365 100 -> Plus
3R 20707229..20707730 2689..3190 100 -> Plus
3R 20705089..20706870 907..2688 100 -> Plus
3R 20704758..20705024 640..906 100 -> Plus
3R 20704556..20704687 508..639 100 -> Plus
3R 20701557..20701656 408..507 100 -> Plus
3R 20698592..20698998 1..407 100 -> Plus

FI05285.pep Sequence

Translation from 519 to 3038

> FI05285.pep
MPAKVNKKENLDDLKQELDIDFHKISPEELYQRFQTHPENGLSHAKAKEN
LERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQAST
SEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATV
IREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGE
SEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIA
GLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAV
IFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTS
TICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKAL
SRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIR
KRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTI
FINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKF
NTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHP
ITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELR
DVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVND
SPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVSLDL
CPKPKLHRRLKLKLLLSQYHSSKLYSYTSCSPSQLIVKN*

FI05285.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17998-PA 1041 GF17998-PA 40..835 1..796 4195 98.9 Plus
Dana\GF12053-PA 1002 GF12053-PA 3..800 21..794 885 31.9 Plus
Dana\GF13018-PA 1041 GF13018-PA 38..835 12..796 878 28.8 Plus
Dana\GF10997-PA 1035 GF10997-PA 146..859 26..794 826 31.7 Plus
Dana\GF21692-PA 1141 GF21692-PA 362..865 300..809 537 33.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24266-PA 1041 GG24266-PA 40..835 1..796 4225 99.6 Plus
Dere\GG16375-PA 925 GG16375-PA 1..719 75..796 2637 67.6 Plus
Dere\GG21788-PA 1028 GG21788-PA 20..829 3..804 909 29.7 Plus
Dere\GG19978-PA 1002 GG19978-PA 3..800 21..794 899 32.1 Plus
Dere\GG16277-PA 1126 GG16277-PA 237..950 26..794 820 31.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21713-PA 1042 GH21713-PA 40..836 1..796 4189 98.9 Plus
Dgri\GH20185-PA 1020 GH20185-PA 3..800 21..794 883 31.9 Plus
Dgri\GH20530-PA 854 GH20530-PA 1..664 144..804 875 31.8 Plus
Dgri\GH16765-PA 1042 GH16765-PA 160..866 33..794 820 31.4 Plus
Dgri\GH23619-PA 1035 GH23619-PA 393..844 300..809 500 32.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-PD 839 CG5670-PD 1..839 1..839 4290 100 Plus
Atpalpha-PK 1002 CG5670-PK 1..796 1..796 4067 100 Plus
Atpalpha-PJ 1002 CG5670-PJ 1..796 1..796 4067 100 Plus
Atpalpha-PA 1041 CG5670-PA 40..835 1..796 4067 100 Plus
Atpalpha-PH 1002 CG5670-PH 1..796 1..796 4067 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10755-PA 1039 GI10755-PA 38..833 1..796 4166 98 Plus
Dmoj\GI21352-PA 698 GI21352-PA 14..687 4..680 2319 63.7 Plus
Dmoj\GI18976-PA 963 GI18976-PA 4..746 61..796 945 28.6 Plus
Dmoj\GI20714-PA 1002 GI20714-PA 3..800 21..794 903 32.2 Plus
Dmoj\GI13426-PA 1033 GI13426-PA 144..857 26..794 821 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24291-PA 895 GL24291-PA 32..827 1..796 4173 98.1 Plus
Dper\GL16518-PA 2190 GL16518-PA 1199..1984 8..796 2855 67.4 Plus
Dper\GL16920-PA 1000 GL16920-PA 43..794 22..796 925 30.7 Plus
Dper\GL10916-PA 1002 GL10916-PA 3..800 21..794 870 31.6 Plus
Dper\GL24999-PA 657 GL24999-PA 12..481 284..794 577 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19046-PG 817 GA19046-PG 1..797 1..797 4183 98.2 Plus
Dpse\GA19046-PF 1002 GA19046-PF 1..796 1..796 4169 98.1 Plus
Dpse\GA19046-PC 1041 GA19046-PC 40..835 1..796 4169 98.1 Plus
Dpse\GA19046-PA 1041 GA19046-PA 40..835 1..796 4168 98.2 Plus
Dpse\GA19046-PE 1002 GA19046-PE 1..796 1..796 4166 98.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15055-PA 1041 GM15055-PA 40..835 1..796 4231 99.9 Plus
Dsec\GM10716-PA 925 GM10716-PA 1..719 75..796 2649 68.6 Plus
Dsec\GM15491-PA 1002 GM15491-PA 3..800 21..794 894 32 Plus
Dsec\GM15637-PA 2010 GM15637-PA 1044..1785 41..779 867 30.4 Plus
Dsec\GM22470-PA 1037 GM22470-PA 148..861 26..794 823 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19388-PA 1092 GD19388-PA 40..835 1..796 4230 99.7 Plus
Dsim\GD19691-PA 1009 GD19691-PA 17..803 7..796 2843 67 Plus
Dsim\GD15051-PA 1012 GD15051-PA 156..869 26..794 823 31.7 Plus
Dsim\GD24384-PA 1023 GD24384-PA 330..802 300..809 551 33.6 Plus
Dsim\GD24994-PA 688 GD24994-PA 3..604 21..575 495 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10697-PA 1041 GJ10697-PA 40..835 1..796 4158 97.9 Plus
Dvir\GJ18574-PA 894 GJ18574-PA 23..804 10..796 2869 68.4 Plus
Dvir\GJ22439-PA 943 GJ22439-PA 17..714 92..779 936 31.4 Plus
Dvir\GJ21881-PA 987 GJ21881-PA 3..785 21..794 911 32.6 Plus
Dvir\GJ11786-PA 1037 GJ11786-PA 148..861 26..794 828 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11950-PA 1036 GK11950-PA 35..830 1..796 4190 98.9 Plus
Dwil\GK23675-PA 548 GK23675-PA 1..477 137..614 1750 68.2 Plus
Dwil\GK17901-PA 988 GK17901-PA 40..812 22..796 1049 31.9 Plus
Dwil\GK15853-PA 1002 GK15853-PA 3..800 21..794 889 31.7 Plus
Dwil\GK20534-PA 1059 GK20534-PA 170..883 26..794 821 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25699-PA 1033 GE25699-PA 32..827 1..796 4227 99.7 Plus
Dyak\GE14534-PA 959 GE14534-PA 1..753 41..796 2763 67.6 Plus
Dyak\GE11511-PA 1002 GE11511-PA 3..800 21..794 898 32.1 Plus
Dyak\GE11863-PA 1028 GE11863-PA 23..829 6..804 879 28.4 Plus
Dyak\GE22637-PA 1032 GE22637-PA 143..856 26..794 825 31.7 Plus

FI05285.hyp Sequence

Translation from 519 to 3038

> FI05285.hyp
MPAKVNKKENLDDLKQELDIDFHKISPEELYQRFQTHPENGLSHAKAKEN
LERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQAST
SEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATV
IREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGE
SEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIA
GLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAV
IFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTS
TICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKAL
SRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIR
KRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTI
FINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKF
NTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHP
ITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELR
DVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVND
SPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVSLDL
CPKPKLHRRLKLKLLLSQYHSSKLYSYTSCSPSQLIVKN*

FI05285.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-PD 839 CG5670-PD 1..839 1..839 4290 100 Plus
Atpalpha-PK 1002 CG5670-PK 1..796 1..796 4067 100 Plus
Atpalpha-PJ 1002 CG5670-PJ 1..796 1..796 4067 100 Plus
Atpalpha-PA 1041 CG5670-PA 40..835 1..796 4067 100 Plus
Atpalpha-PH 1002 CG5670-PH 1..796 1..796 4067 100 Plus