Clone FI05294 Report

Search the DGRC for FI05294

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:94
Vector:pOT2
Associated Gene/Transcriptboi-RB
Protein status:FI05294.pep: gold
Sequenced Size:4202

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
boi 2008-08-15 Release 5.9 accounting
boi 2008-12-18 5.12 accounting

Clone Sequence Records

FI05294.complete Sequence

4202 bp assembled on 2008-07-17

GenBank Submission: BT044213.1

> FI05294.complete
CGGAGTCTGCGCGAAACTATAACAGAGTTATATTTGAATATATATCTCAA
AATAAAATCGTCGTGCTAATAACGGTTATTTGTTTACCTTTTTTTTGGCT
GTTCTAAATCCCTAGTGCGACAAGCGGCGCAGATTGGAATTGGATTTGGA
TAGAGGATTTAGCTGCCCTTCGAGGTTTCAGTCAACAGAATGCAGTTCTA
AAGCAGCAGATACGCCTGGAAAGAGACAGCAAGACAGCAGGAAAAAGAGA
CGGAGGGATAAGCAAGTGACAAAGGGTACAAAAGAGTAGGATCTGCTTCG
CAATGGCTGAAATCAGGCTAGTTGTGGTTCTACTGGTCCTTATGACCACC
TGTATCTATACACTTCAAGCCAGTGACAGTAATTCCTCCGTGGCAACCAC
CTTGGGCGTTTTGTTCGAGAGGGCTCCCGAATCAGCGGTGGCCCCGAAAG
GAGATGAGGTGGTCTTCGAGTGCGAGCTGAATCTGAAACCTGATCGCCTG
GAGTGGCGGTTTAGACGTGGTGATTCCTCGGAGCCCTATCTATACCTAAG
GCCCTCGGCTGGCTATAACGTGACCAGCGGAAGCGATGGTCTTGCCTGGA
GACTGCGCATCTATGTGAGTGCCCAAACGGCTGGGGACTACCAGTGTGTG
GCTTGGTATGGCCCGGGTGCACTGGCTTCCACGCCAGCCCGCTTGGCCTT
GGTCTCGATTGCTTTGGACGTCGGCCAGGGATCCATGGGGGCCAGGAGCT
CCATCCGCTGGAGCGTGGCGCCCAAAAACTGCCTGCTCATTCGTTGCGGC
AGCGTAATATCGAATCCGCCGGCTATTTGGAGCTTCTACAGAAACGGAAA
GAAGCTACCTCAATCGGAGCTGCTGCCTGGCGCTGCGGGGGCATTGGTTT
TGGATACGGTCACCGCCAAAGATGCGGGTAACTACTCGTGCGTGGCCACG
AACTCCATAACAGGCGATGAACTTAGGCTCCCCCAAACTATTGAACTAAG
AGTGGACTACACAGATAGGACACCTCCGTACTTTCTACAACGTCCACCCA
TCGAATACTCAGCTCGTCCCGGAGAAACAGTGGTGCTCGAGTGTCCTGGC
GTGGGATCCCCACGACCCCGAGTCATTTGGAGTAGTCCCAATGTGGTTGA
GATCTATAATAATAGAAGCACCATCCTGTCCTACGGCCTGCAAATCACCG
ATGTGAAGCCCGAGGATCAGGGTTCCTATATCTGCATGCTGGACAATGGT
ATTGCACCACCGATCGATCACACCATCAAGTTGAGTGTTTTGCAGCGGCC
CACGATCTTAAGAGGACCGGCCGCCACTCTGACGAATGAGAGCAATCCTT
TGCTGCTGGATTGCTCCGCCTCGGGGAATCCCCAACCCGATATTTATTGG
CTTATAAACGGTGAGGATGCCACCAAAGATCCGGAGGCTGTGGTGGATAA
CCGGAGCCTGCAGCTGAAGCGAGTTCAAAAGCGTCACGCTGGCGTGGTTC
AGTGCTTTGCAAAGAACATTTTGGGAGAGACGAGCGAGGGAAACATATTG
CGCGTGAATCCCCTGGAAATCACCGGCGAGGATGACGAACCACTTGGCGA
AGTTCCCGTGTGGCCAGTTCATGAATCCAACACTGGAATGGGCACCTCGT
CAACATCTGGAGGCTCCAAAAACAAGAGCGGCAGACGAAAGTTTAAGGCG
AGCATGGTGCCTCCGTCACGACCCAATGTCACCCGTCTGTCGGACGAGTC
CGTGATGCTGCGCTGGAGTGTGCCACAAAACTCTGGACTCCAGATCACCT
TTTTCAAGGTGCAGTATCGCATGTTGGGCGACGGAAAAAATCGGAGGAAG
AACTGGCAGACGACCAGCGACAATATCCCGTACGGAAACGCGCACGGATC
CGGGCCTGGCCAGGGGAACAGTCACTGGCGGGCGCGGAACCGGGACAGGG
AGTATGAAATGGGCAATCCGCCCAAGAACTTCACCTCCTCCGTTACGGGA
CTGACCGCCGGCAAGTACTACCGCTTCCGGATCGTGGCGGTGTACTCCAA
TAACGACAACAAGGAGGGCAACACCTCCCTCAAGTTCTTCCTGCAGAATG
GAACGTCCAAGTCGAATCTGCCAGTGCCGGAACTACGCGAGGTGGAGACG
CTTTCCGAGTCGGCCGTGGTGCTCCATTGGTCCCTGGTATCCTCGACTCA
AAATGAGGATATAGACGGGTACTATGCCTACTATAGGCCAGCGGACTCAG
CAGCGGAGTATTTGAAGGCCACGGTGGATGGCGGAATGAGCAGGAGCTTC
AAGATAGACCTCCTTCGTCCAGGAACCCCTTATGAGTTCAAATTGCAATC
GTTCAACTCCGACGCAGCCTCTGAATTCAGTGCTATTCGGCAAGCGAGGA
CCAGAAAAACGCACGAGCAACCGGCTTCATCTTCGGCCACGCCAGTGCCA
GCCAATAAGGCAGTGGAACAGCACCAGAACTCCTTATATCCACTGATCGC
AGGTGCCGCTGGCGGAGGCATACTACTCCTCATCGCCTCATTGGTGGTCT
GCCTTTGCCTAAAGAGACGGGAAAACTCTCAGCCGGAGGATGAGAACAAA
CCGCAATTGGAACACATTCAAGCGGACTTTGTTACCTCCGCCGTCCTGGG
AGTTGGTGGCCACCACAAAAGTGGCGATGTAAGGCGCCTCAACGGAGTGA
TTCCGAGGATGAATATTACGCCCAATCCGCTGGCCCAGGAAACGGCATCC
GATAAGAACAACTCTGGACTGCATCAGAATGGCCTTCACCACGCACAGCC
GTACCATCCGCCTGGCACGCCCACTCTGATGCACAAGCGACTGGACTACC
ACCAGCAGCCGCCGCCGGTGCCTCCGCACTCGGCCTATTACCAACAGGCA
CCCACGCACCAGCCGTCGCCGATGATGGAGCGCAGTGTCAGGGGTCACCA
GCAGCCCGGGGGCTTTCATATGGAGGAGGGCACACCCACGCCGACCAGGA
TACCATCCCTGCGGCGACAGCGACGCACCTCGGGCAACCAGCAGGTGCAC
AACAGCCACAGCAATCTCAATATTGGCCTGAGCCACCACAACAACAACAA
CAACAACCTGCCGCCGCACCACCAGCATCTGCACCACCACCCCGGCCATC
CGGGTGGCCTGGTGGGCATACCCATCGTGCCAGGGAGCCCTAGGGTCCAG
AGATCGCCGATGCCGAGCAGGGCGATGATCAAGAGGACGCGCCTGGGCAG
CCACACGGACAACATATCGTCGGGCAGTCTGAACAGTATTGAGGTGTGAT
GGCTCGCAGAGGAGGCAACTAACTAGTGGACTAGTGGGCGGAGCAGCACA
ACGAGGAGAAATATACCTAAGCGGCAAGCGAAAGTGGTTCCCCAAAAACA
GACAGTTTCAAGTAGACTTAAGGATCCGAAACTAGATGTGTATTATTGAG
ATAATCGTAGGACAGGTCGGCAGAGCAGCTCGAAACCCTCGAATATTAGC
TTTAAGGCACCCGGTACTGTTTAGTTTTCCAAAAAACCAATTAATTTGGC
CAATCATTAAGCTTAGAACTAGGGAATTTGCCATTAACAGAAGTTTCTGT
CGTTTCAAATGCTCGAGTAACTTTGTGCTAAAACACTAGTAATCAAGTTT
TGTTTTCATTTTGAGCTCATTAAAATGTATTTCGAGCAGAACGTTTAATT
AAAAGAAAAAAACAGCTAAGCAGCTAAGTCGTTAAACGTTAATGCTGCTT
CGTTTTGTTTTAGTTAAATATTGAATTTGAAAATATACAAACTTTAGTAT
AAGGAATTGGTAATGTAAGACTTTTTTCGTTGCTGCCGGCCAGATAGTCA
GTAGAATTACTAATGTTAAGTTTTTTTTTTTATTATTGATAGAACTATTT
TGGGGGCCAAATTTTATCTCGAATAATCCCTGTAGCATAGCGTTATTTAT
TTATTGCAGTTTAAGCGTCAGTCGTCAGCAACTCAAATTGATTAGTTCAA
TTAACAAGCAACCTAATGTACGTTTAAGTCAAACCAACTATTTAGCATTA
AGTTAATACATTTCTAGATGTGACTAATACACAAAACCCAAGAGAGAAGC
ATCCTAAACTCGATTTAAGCTCATAGGCGGCAGTTTTAAACGAATATGCG
AGTCCTGAAATTAAAAAGTGAATCTTTGAACATAAAAAAAAAAAAAAAAA
AA

FI05294.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
boi-RB 4312 boi-RB 127..4310 1..4184 20785 99.7 Plus
boi-RD 4522 boi-RD 1..2757 1..2757 13755 99.9 Plus
boi-RA 2721 boi-RA 234..2719 1699..4184 12325 99.7 Plus
boi-RD 4522 boi-RD 3093..4520 2757..4184 7035 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2338057..2339485 4183..2755 7055 99.6 Minus
chrX 22417052 chrX 2344793..2346039 1529..283 6115 99.4 Minus
chrX 22417052 chrX 2340780..2341488 2406..1698 3530 99.9 Minus
chrX 22417052 chrX 2340532..2340714 2589..2407 915 100 Minus
chrX 22417052 chrX 2344560..2344730 1698..1528 855 100 Minus
chrX 22417052 chrX 2340301..2340468 2756..2589 840 100 Minus
chrX 22417052 chrX 2363772..2363884 113..1 565 100 Minus
chrX 22417052 chrX 2350484..2350582 284..186 495 100 Minus
chrX 22417052 chrX 2363218..2363292 188..114 375 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
boi-RF 2997 CG32796-PF 1..2997 303..3299 14970 100 Plus
boi-RE 2997 CG32796-PE 1..2997 303..3299 14970 100 Plus
boi-RB 2997 CG32796-PB 1..2997 303..3299 14970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
boi-RB 4223 CG32796-RB 41..4223 1..4183 20780 99.8 Plus
boi-RF 4509 CG32796-RF 440..4509 114..4183 20215 99.8 Plus
boi-RE 4316 CG32796-RE 247..4316 114..4183 20215 99.8 Plus
boi-RF 4509 CG32796-RF 41..153 1..113 565 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
boi-PF 998 CG32796-PF 1..998 303..3296 4707 100 Plus
boi-PE 998 CG32796-PE 1..998 303..3296 4707 100 Plus
boi-PB 998 CG32796-PB 1..998 303..3296 4707 100 Plus
boi-PG 1105 CG32796-PG 1..821 303..2765 4039 99.8 Plus
boi-PA 547 CG32796-PA 15..547 1698..3296 2431 99.8 Plus
boi-PG 1105 CG32796-PG 908..1105 2703..3296 686 92.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2444166..2445595 4184..2755 7045 99.5 Minus
X 23542271 X 2450903..2452149 1529..283 6205 99.8 Minus
X 23542271 X 2446890..2447598 2406..1698 3545 100 Minus
X 23542271 X 2446642..2446824 2589..2407 915 100 Minus
X 23542271 X 2450670..2450840 1698..1528 855 100 Minus
X 23542271 X 2446411..2446578 2756..2589 840 100 Minus
X 23542271 X 2469891..2470003 113..1 565 100 Minus
X 23542271 X 2456591..2456689 284..186 495 100 Minus
X 23542271 X 2469337..2469411 188..114 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2452264..2453693 4184..2755 7045 99.5 Minus
X 23527363 X 2459001..2460247 1529..283 6205 99.8 Minus
X 23527363 X 2454988..2455696 2406..1698 3545 100 Minus
X 23527363 X 2454740..2454922 2589..2407 915 100 Minus
X 23527363 X 2458768..2458938 1698..1528 855 100 Minus
X 23527363 X 2454509..2454676 2756..2589 840 100 Minus
X 23527363 X 2477989..2478101 113..1 565 100 Minus
X 23527363 X 2464689..2464787 284..186 495 100 Minus
X 23527363 X 2477435..2477509 188..114 375 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:49:20 has no hits.

FI05294.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:55:49 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2363772..2363884 1..113 100   Minus
chrX 2363218..2363292 114..188 100 <- Minus
chrX 2350484..2350579 189..284 100 <- Minus
chrX 2344793..2346037 285..1529 99 <- Minus
chrX 2344560..2344728 1530..1698 100 <- Minus
chrX 2340780..2341487 1699..2406 99 <- Minus
chrX 2340532..2340714 2407..2589 100 <- Minus
chrX 2340301..2340467 2590..2756 100 <- Minus
chrX 2338057..2339483 2757..4183 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:11 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..2997 303..3299 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:07 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RE 1..2997 303..3299 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:41 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..2997 303..3299 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:32 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..2997 303..3299 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:49 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..2997 303..3299 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:11 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..4183 1..4183 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:06 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..4183 1..4183 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:41 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 41..4223 1..4183 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:32 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 1..4183 1..4183 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:49 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 41..4223 1..4183 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:55:49 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
X 2469891..2470003 1..113 100   Minus
X 2469337..2469411 114..188 100 <- Minus
X 2456591..2456686 189..284 100 <- Minus
X 2450903..2452147 285..1529 99 <- Minus
X 2450670..2450838 1530..1698 100 <- Minus
X 2446890..2447597 1699..2406 100 <- Minus
X 2446642..2446824 2407..2589 100 <- Minus
X 2446411..2446577 2590..2756 100 <- Minus
X 2444167..2445593 2757..4183 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:41 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2363924..2364036 1..113 100   Minus
arm_X 2363370..2363444 114..188 100 <- Minus
arm_X 2350624..2350719 189..284 100 <- Minus
arm_X 2344936..2346180 285..1529 99 <- Minus
arm_X 2344703..2344871 1530..1698 100 <- Minus
arm_X 2340923..2341630 1699..2406 100 <- Minus
arm_X 2340675..2340857 2407..2589 100 <- Minus
arm_X 2340444..2340610 2590..2756 100 <- Minus
arm_X 2338200..2339626 2757..4183 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:00 Download gff for FI05294.complete
Subject Subject Range Query Range Percent Splice Strand
X 2477989..2478101 1..113 100   Minus
X 2477435..2477509 114..188 100 <- Minus
X 2464689..2464784 189..284 100 <- Minus
X 2459001..2460245 285..1529 99 <- Minus
X 2458768..2458936 1530..1698 100 <- Minus
X 2454988..2455695 1699..2406 100 <- Minus
X 2454740..2454922 2407..2589 100 <- Minus
X 2454509..2454675 2590..2756 100 <- Minus
X 2452265..2453691 2757..4183 99 <- Minus

FI05294.pep Sequence

Translation from 302 to 3298

> FI05294.pep
MAEIRLVVVLLVLMTTCIYTLQASDSNSSVATTLGVLFERAPESAVAPKG
DEVVFECELNLKPDRLEWRFRRGDSSEPYLYLRPSAGYNVTSGSDGLAWR
LRIYVSAQTAGDYQCVAWYGPGALASTPARLALVSIALDVGQGSMGARSS
IRWSVAPKNCLLIRCGSVISNPPAIWSFYRNGKKLPQSELLPGAAGALVL
DTVTAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRTPPYFLQRPPI
EYSARPGETVVLECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYGLQITD
VKPEDQGSYICMLDNGIAPPIDHTIKLSVLQRPTILRGPAATLTNESNPL
LLDCSASGNPQPDIYWLINGEDATKDPEAVVDNRSLQLKRVQKRHAGVVQ
CFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSS
TSGGSKNKSGRRKFKASMVPPSRPNVTRLSDESVMLRWSVPQNSGLQITF
FKVQYRMLGDGKNRRKNWQTTSDNIPYGNAHGSGPGQGNSHWRARNRDRE
YEMGNPPKNFTSSVTGLTAGKYYRFRIVAVYSNNDNKEGNTSLKFFLQNG
TSKSNLPVPELREVETLSESAVVLHWSLVSSTQNEDIDGYYAYYRPADSA
AEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAIRQART
RKTHEQPASSSATPVPANKAVEQHQNSLYPLIAGAAGGGILLLIASLVVC
LCLKRRENSQPEDENKPQLEHIQADFVTSAVLGVGGHHKSGDVRRLNGVI
PRMNITPNPLAQETASDKNNSGLHQNGLHHAQPYHPPGTPTLMHKRLDYH
QQPPPVPPHSAYYQQAPTHQPSPMMERSVRGHQQPGGFHMEEGTPTPTRI
PSLRRQRRTSGNQQVHNSHSNLNIGLSHHNNNNNNLPPHHQHLHHHPGHP
GGLVGIPIVPGSPRVQRSPMPSRAMIKRTRLGSHTDNISSGSLNSIEV*

FI05294.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21949-PA 1001 GF21949-PA 1..1001 1..998 3455 71.5 Plus
Dana\GF14467-PA 880 GF14467-PA 38..753 35..777 1497 44 Plus
Dana\GF13393-PA 1535 GF13393-PA 42..442 38..420 252 26.6 Plus
Dana\GF11332-PA 1392 GF11332-PA 306..744 197..684 245 24.1 Plus
Dana\GF11332-PA 1392 GF11332-PA 60..453 42..442 244 24.6 Plus
Dana\GF14429-PA 2028 GF14429-PA 46..332 163..434 228 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12612-PA 1103 GG12612-PA 1..817 1..819 3983 92.4 Plus
Dere\GG23567-PA 879 GG23567-PA 46..796 35..833 1526 44.2 Plus
Dere\GG12612-PA 1103 GG12612-PA 923..1103 818..998 734 96.7 Plus
Dere\GG20315-PA 1508 GG20315-PA 19..414 38..420 240 26.5 Plus
Dere\GG20100-PA 1429 GG20100-PA 342..780 197..684 240 25.3 Plus
Dere\GG20100-PA 1429 GG20100-PA 96..489 42..442 236 24.4 Plus
Dere\GG21203-PA 2028 GG21203-PA 46..332 163..434 228 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12751-PA 1292 GH12751-PA 74..929 7..819 2653 64.2 Plus
Dgri\GH11362-PA 888 GH11362-PA 29..736 35..777 1591 47 Plus
Dgri\GH22099-PA 1391 GH22099-PA 33..426 42..442 244 24.3 Plus
Dgri\GH10329-PA 1565 GH10329-PA 105..483 42..419 237 27.1 Plus
Dgri\GH14935-PA 1893 GH14935-PA 266..566 105..411 218 27.9 Plus
Dgri\GH12751-PA 1292 GH12751-PA 1247..1292 953..998 212 91.3 Plus
Dgri\GH22099-PA 1391 GH22099-PA 279..502 197..418 196 28.8 Plus
Dgri\GH10329-PA 1565 GH10329-PA 199..751 38..645 185 23.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
boi-PF 998 CG32796-PF 1..998 1..998 5281 100 Plus
boi-PE 998 CG32796-PE 1..998 1..998 5281 100 Plus
boi-PB 998 CG32796-PB 1..998 1..998 5281 100 Plus
boi-PG 1105 CG32796-PG 1..821 1..821 4277 99.8 Plus
boi-PA 547 CG32796-PA 15..547 466..998 2850 99.8 Plus
boi-PG 1105 CG32796-PG 908..1105 801..998 1022 92.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15895-PA 1068 GI15895-PA 11..971 10..922 2908 63.9 Plus
Dmoj\GI17739-PA 897 GI17739-PA 41..750 35..777 1648 46.3 Plus
Dmoj\GI19234-PA 1401 GI19234-PA 37..430 42..442 241 24.6 Plus
Dmoj\GI19122-PA 1512 GI19122-PA 11..412 23..420 240 25.9 Plus
Dmoj\GI17087-PA 1413 GI17087-PA 41..418 42..419 235 27.1 Plus
Dmoj\GI19234-PA 1401 GI19234-PA 283..506 197..418 209 28.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25599-PA 906 GL25599-PA 40..807 35..826 1505 43.2 Plus
Dper\GL14456-PA 736 GL14456-PA 1..362 59..420 1265 65.7 Plus
Dper\GL14456-PA 736 GL14456-PA 351..726 558..904 1236 70.5 Plus
Dper\GL10711-PA 1362 GL10711-PA 29..407 42..422 242 24.9 Plus
Dper\GL26255-PA 2029 GL26255-PA 46..585 163..681 223 23.7 Plus
Dper\GL14802-PA 1516 GL14802-PA 137..498 42..405 214 26.8 Plus
Dper\GL10711-PA 1362 GL10711-PA 275..498 197..418 189 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22276-PA 1026 GA22276-PA 32..1026 35..998 3254 68.1 Plus
Dpse\GA21616-PA 903 GA21616-PA 40..804 35..826 1508 43.2 Plus
Dpse\GA21177-PB 1559 GA21177-PB 1..439 1..433 254 26.2 Plus
Dpse\GA12341-PA 1398 GA12341-PA 65..458 42..442 242 24.4 Plus
Dpse\GA28096-PA 2029 GA28096-PA 46..585 163..681 223 23.7 Plus
Dpse\GA12341-PA 1398 GA12341-PA 311..534 197..418 190 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18878-PA 998 GM18878-PA 1..998 1..998 4963 97.9 Plus
Dsec\GM13730-PA 880 GM13730-PA 46..749 35..777 1544 45.5 Plus
Dsec\GM15615-PA 1429 GM15615-PA 96..489 42..442 237 24.6 Plus
Dsec\GM15615-PA 1429 GM15615-PA 342..780 197..684 230 24.1 Plus
Dsec\GM21402-PA 1514 GM21402-PA 16..765 13..700 224 22.2 Plus
Dsec\GM21680-PA 1305 GM21680-PA 276..526 172..426 220 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16363-PA 998 GD16363-PA 1..998 1..998 4964 98.2 Plus
Dsim\GD22528-PA 713 GD22528-PA 44..582 240..777 734 38.1 Plus
Dsim\GD22528-PA 713 GD22528-PA 46..268 35..258 342 40 Plus
Dsim\GD25109-PA 1429 GD25109-PA 96..489 42..442 237 24.6 Plus
Dsim\GD25109-PA 1429 GD25109-PA 342..780 197..684 234 24.9 Plus
Dsim\GD24230-PA 2043 GD24230-PA 61..347 163..434 228 29.9 Plus
Dsim\GD22909-PA 1405 GD22909-PA 40..400 42..405 215 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16643-PA 1042 GJ16643-PA 39..937 34..913 2926 67.6 Plus
Dvir\GJ17563-PA 907 GJ17563-PA 44..757 36..777 1662 48.6 Plus
Dvir\GJ22254-PA 1530 GJ22254-PA 33..426 35..420 240 26.6 Plus
Dvir\GJ10767-PA 1520 GJ10767-PA 129..507 42..419 238 27.1 Plus
Dvir\GJ20309-PA 1390 GJ20309-PA 34..412 42..422 232 24.6 Plus
Dvir\GJ10767-PA 1520 GJ10767-PA 348..678 172..525 165 23.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24917-PA 1040 GK24917-PA 1..1040 1..998 2952 62.6 Plus
Dwil\GK24246-PA 881 GK24246-PA 24..764 21..797 1455 44.2 Plus
Dwil\GK23150-PA 1359 GK23150-PA 8..723 38..693 256 22.5 Plus
Dwil\GK21847-PA 1406 GK21847-PA 31..424 42..442 242 24.4 Plus
Dwil\GK21847-PA 1406 GK21847-PA 253..715 172..684 231 23.6 Plus
Dwil\GK14947-PA 1401 GK14947-PA 106..467 42..405 221 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16943-PA 1103 GE16943-PA 1..818 1..819 4048 92.9 Plus
Dyak\GE18390-PA 880 GE18390-PA 46..749 35..777 1490 45.4 Plus
Dyak\GE16943-PA 1103 GE16943-PA 926..1103 818..998 764 94.5 Plus
Dyak\GE12474-PA 1525 GE12474-PA 16..432 13..420 241 26.7 Plus
Dyak\GE11841-PA 1436 GE11841-PA 101..494 42..442 239 24.6 Plus
Dyak\GE13277-PA 2028 GE13277-PA 46..332 163..434 229 29.9 Plus
Dyak\GE11841-PA 1436 GE11841-PA 347..570 197..418 208 28.8 Plus

FI05294.hyp Sequence

Translation from 302 to 3298

> FI05294.hyp
MAEIRLVVVLLVLMTTCIYTLQASDSNSSVATTLGVLFERAPESAVAPKG
DEVVFECELNLKPDRLEWRFRRGDSSEPYLYLRPSAGYNVTSGSDGLAWR
LRIYVSAQTAGDYQCVAWYGPGALASTPARLALVSIALDVGQGSMGARSS
IRWSVAPKNCLLIRCGSVISNPPAIWSFYRNGKKLPQSELLPGAAGALVL
DTVTAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRTPPYFLQRPPI
EYSARPGETVVLECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYGLQITD
VKPEDQGSYICMLDNGIAPPIDHTIKLSVLQRPTILRGPAATLTNESNPL
LLDCSASGNPQPDIYWLINGEDATKDPEAVVDNRSLQLKRVQKRHAGVVQ
CFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSS
TSGGSKNKSGRRKFKASMVPPSRPNVTRLSDESVMLRWSVPQNSGLQITF
FKVQYRMLGDGKNRRKNWQTTSDNIPYGNAHGSGPGQGNSHWRARNRDRE
YEMGNPPKNFTSSVTGLTAGKYYRFRIVAVYSNNDNKEGNTSLKFFLQNG
TSKSNLPVPELREVETLSESAVVLHWSLVSSTQNEDIDGYYAYYRPADSA
AEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAIRQART
RKTHEQPASSSATPVPANKAVEQHQNSLYPLIAGAAGGGILLLIASLVVC
LCLKRRENSQPEDENKPQLEHIQADFVTSAVLGVGGHHKSGDVRRLNGVI
PRMNITPNPLAQETASDKNNSGLHQNGLHHAQPYHPPGTPTLMHKRLDYH
QQPPPVPPHSAYYQQAPTHQPSPMMERSVRGHQQPGGFHMEEGTPTPTRI
PSLRRQRRTSGNQQVHNSHSNLNIGLSHHNNNNNNLPPHHQHLHHHPGHP
GGLVGIPIVPGSPRVQRSPMPSRAMIKRTRLGSHTDNISSGSLNSIEV*

FI05294.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
boi-PF 998 CG32796-PF 1..998 1..998 5281 100 Plus
boi-PE 998 CG32796-PE 1..998 1..998 5281 100 Plus
boi-PB 998 CG32796-PB 1..998 1..998 5281 100 Plus
boi-PG 1105 CG32796-PG 1..821 1..821 4277 99.8 Plus
boi-PA 547 CG32796-PA 15..547 466..998 2850 99.8 Plus
boi-PG 1105 CG32796-PG 908..1105 801..998 1022 92.4 Plus