Clone FI05296 Report

Search the DGRC for FI05296

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:96
Vector:pOT2
Associated Gene/TranscriptCG43427-RE
Protein status:FI05296.pep: gold
Sequenced Size:5893

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31531 2008-12-18 5.12 accounting

Clone Sequence Records

FI05296.complete Sequence

5893 bp assembled on 2008-09-12

GenBank Submission: BT044214.1

> FI05296.complete
CCAAAAGGAGGTGGCTAAGAGTTTAGCGCGGCACGCAAGCACATAATTCC
CCGCTCGGACGTGATTTCGCCCCTTGGTACATGAATACATGTGAATGTGT
ACATATGTGCGCACGGGAAATAAGGCAGGAAAAGCCCAAAGCCACGGAGT
TCGGATCCGAGAGTCTTGCGTTTTGTTTTGCGCAGCACTGCACCTGTGCA
GTGTAAAATCGTGAATTCAGTCGAGGTGCAACTGCGGCGCTTGTGCGGTT
GAGGGAGGAGAGTTGGCAGAAGTGTGTTTGTGTGTGTATGTGGGTGGGTA
GTGCCTTTTATTTCCGATTTTGACGGGAGTCCAATCCACCAAGCTGAGTA
GTTGCAATTACGGCGCGGCGGAAAACTGTTTTTCTCGCTCACAAATACAT
ATGTACAACCTGTATAAACAACAACGACTGCCGTAAACAGCCAACTGCGA
ACGCAGCAACAACAACAGTTCTAACAACAGTACACAAGCAAACACGTTTC
CCGTTTTATTTTCTGGCCCGCGTTTATTAGTGTGTGTGGGTGCGCCTCTG
TGTGCGAGTGCGTATGTGTGCGTGTGTACGTGTTGCTCGCTCGAGTATAG
AAATTTCTAATGATTTTTGGCCTGTTCCCGAAAAGCAGCTCCAAACAACA
ACAACAACAACTTTAGGACTCTGCAGTGGCTGTTCCAATTGACTCGCCAT
TCTTTTGAATTGTTTTTATATATGTAATTGAACGCCGAAAAACAACTGTG
TAAAAAACAGCATCTGTGCCAGCAACGAACAGAGCTTCGAATTTTGTTGT
TTTTAATGTAGATTCCAGAAAATTTGAAAAAGGAAACCGAACTGTTTTGT
AAGATACAAACGAGCAAAACATCGACCAATAAACATCCCACTCTGTAAAG
GAATTTCAAAGGCTAATGAAATTGGACACATCCGAAGACCTCGCCCGATG
TGCGTGGGTGCTGGCGCATCGCCTTTGAATCGAATTCAGAGACATGGTGA
GTCACTGACCAGAGGCCAAGAAACCCGCGTAGGAGTTCGGTGTCATGTGA
GCAGAGATCAGTCAACAAACACAACATTCAACGGAAGGCGAAATTACAGC
ATAGAGCAGACGACACATATCCACAGACAGGTTGCACCATCGAGGAGCTC
CATATGGAGGCCACTGATCAGGAGGTCATGCTGGAGGGCAGGGAAGACCT
CATGTCCACATCGGCGACATCGTCCACAAATGGCGGGGACACTAATGGTT
GCGGCAAAAAATTGTCCGTAACCTCTCCGGATCCCACACCGTACGTGACC
AAGCAGCGAGTGACGCGTCCAACGCCTCCCGCTCCTTCAAAGAATCCGAT
GCAATTCGTCCAGATCAAGCCCTGCAACCTCTACCAGACCGCGCAGGAGC
AGCTGAAGAAGGCCGAGGAGGTCAAGAAGCTGAAGGAGGTGAAGAAGGAG
GAGCCAGAGGAGTGGCAGAACAACCTTGACAATTGGAAATCATCGAGACG
AAAACGTGTCGAACACATCATCGATCGAGCGGTGGAGACCAAGAAACTCG
AGCTGGAGGAGCATGATCGGTTGCGCCGAAAGTCGAAAACATTCACCGAA
ATGATGGAGGAGAGGGCTGAAAGGGGCGGACCTCGGGGGCGTGCCAAGCT
GGCTTCCCTGGCCGTATACAACGAGGATGAGACGAACGACCTGAGTGATT
TGGGGATCGGAACCAGCAGTGCCAGCGGAAAGAGCAGCCTGTCCGGGGAC
TATGACAATAACAGTGTTATGAGCGACCATGCGGCGGAGCTGGATAAGGC
GATTGGAGCAGCTAGCTCTGTAGCTGCTGGAGTAACCGCCCAAAACGTGG
ATGAGCAGCTGAATCACATAAACCGCAACGGTAGTAATGGGAACCACGGG
AACGGAGCGGCTGTTGGCCAGACAGGACCATCAAATTCCTCCAAGTCAGC
AGGGCGGCAATACATCTCCTCGCCAGGATACGATACGTCCTCCAGTAACG
CGCAAGCCAGTTCTCCGGATCTCTGTGAATACACCTACGAAGGAGCCATC
CAGGACTACAAGCAAAGAGTTCAACGGGCCAGCAGCAATGGCAATGGAAA
TGCCAACGGCAAGTTGATTGGAGAACATATTGCTTATCCCACGAGGCGAG
GCTCTAAAATTGAGGATCGATTGAGTGGTTTTGAGGTGACATCGCCAAGC
GACACGCAGGAGGGTGTAGAGAAGCAAAAGGTGGACGTGCCCAAGGTTGA
CATATCCAAACGCAAGGAGATCTTCGAGCAGGCCAAGGCGGAAGTCTCAA
ACGGTGGTGCTCCAGCTGCCCCAAAACTCGTATTTCGTGATGGTCTTACC
AATGGAAATTCAGCTACCACTGCTCCCAAATCGGAGGTGAGGCGTCTTTC
TGGTGACATCTCCAGCATTCGAGATCGCATGCAGAGTTTGGAACAGCAGC
GGAAGGCTTTCAGTTCCAGCAAGAGTGTGGATGTGCCGGTGCCGCCCCTT
AAACAGCGTCTGAATAGTCTGCAGCAGTCCGTTGCCAAAGAGGAGCAGAA
GAAGCCACCGTTGGTGGCGCTCATCGATGCCAGACAACTGGAGATCATGA
GGGGAGAAGAGGAACGTATGCGCCAGCAGCAACAAAAAGAGAAGCATTCA
CCAAGCCAAACTACATTGTGTGCACCTAAGCCAGCTCCTCCTGCCCTTAT
TATTGAGGAACCGCCGGTGGCAGACACCAACGACGACAGCGGCATTCAGG
AGGACACCGCTGATGAACTGCAGCAGCAGCAGCAACTCAACGCAGCCATC
GCCGCCTTGGCGCTCGAGGAGCGCCAGTTGGAGGAAGCAGCCAATGCGGT
CAACCAAATTGAAGCGGAGTTCGATGAGCTGACTGATCTGCATCCCTCGC
CATTGCCACCATCTCCAGCTCTTCCGGCGGTTCAACAAAGCCTCCAACAA
CCGACAGTCGCTCAGGTTCCAGCACAAGCGGTCAATCAGGCGGCTGCTCC
TCCATTGCGGGACATGGAATTTAGTGTAAGTTGTACTAACAATTTTATCG
AACCCGCTAAGATAAGTCCTTGTGATGTTAATGTAGTAGCTGCTTCAGCG
GTGTCGGTGTCCAAATCTGGCCCCACTCCCAATCCCACATCCACTCCAAA
TATGGTATCCTCCTCTCCCAATTGTAACTTGCGTAGAAAGCCCTCCAATG
AAATGGTCCATCATCGCAATTTGCTTAAAATGTTCAAGGAAACCTTTCAA
AACGACGACGATCTGAAAGAGGTCTGCGAGATAGTCACTTCGCCTGGTCA
GTTTACCCAGATCATTGACTTTTCCAAGCGGCCAAGTAATCCCCCCATAC
CAATACCTACTCTACTACCTACCTCTACTCCGATTCCTACCCAGATACCG
CGACCACTGGGCAAGCCGCCCATGTCGCCCAAGGCTGTGAGGTTAGCGTC
CAGTCCTAAGGGACATATAAATCCTTTAAGTTCGCCCACGAACTCCGGGT
TTTCACCCCCCCAATTCAGTATCAATGGGCGTGTGGAGATTTTTAATTCA
CGGCAACTGGACAAGCCGCCCACGCCACCAGCTCCTCCCAAGAAAACTGT
AAGGAGTGAGCATCCTCTTAAGGAAGCGGTTCCTTCACCAGAAGTGGTGA
TGTGCGCTCCTCCTATGACCATCGTTGATCCCGACGAGCTGCCCAAACCA
AATACTGTAAAGGCCCTTTCAAATTGCTTCAGCCAGAGCGATTCCAAGTC
GCTAACATCACCCATAATGTCGCCGAAACCTTTGCCCAGTGGTCGCATTC
CCCAGATCACACCACCTGCTTCTCCAAAGCCCCCGAAACGAGTTCAGCTT
GACGAGGTGGATCGTAGCTCTGGGGACTATGCCCCAGTTGTTGGTCAAAC
CAAGGCAATTGTACACACGCCCCCTAGCAAAATAAATGCCCGGGCAAACC
AAACTCTTGATCCCCTAGCACCCAACGACTCACTGTGCCTGCACACATCT
TCGCCCAGCGAGATACCTTCCTTGAAAGCCTGCTCCCCGAATGAATCCAG
TTTGTTCAAGCTGGCTTCGTCACGACCCACCTCGCCTTCAGTGGATGTGG
CTTCGTGTCAGAAATTTTTGAATAGAGAAGCACCAAAGGATATCCAACTG
GCCGAAGAAGACCGCAAGAGAATGGATCAGTTTGCTGTGGAGGAGATGCC
CTGTGATAAGATCGATGTGACCAAATCACCCCAGCCCAATACTGGTTTCC
AGATTGTGACCGAGGATCTAGTAAAAAAATGTGATGGCAAAAACATATCC
GAAGCGGTAAGGGATCTAGACGTCCCACCCAGCCAAGAAGATATTGCCCT
GTGTGCGGGACTACTAGACTGTTTGGCTCCAGCTCAGGAGCCTATTTGTG
ACAGCATCGATGTGAGGAATGGTCCAGTGCCGGCAACTGGATTTCAGGAC
ATCAGTGAGGAGGAGGTGAAAAAGTGTGAAAAGCATAATAAAAATTATGT
TATCACAAACAGGCCAAGCTCACCCATTGGCAGTGTCAGAGCAGCTCACT
CGAAGGCTTTGATGGACACTTGTGAGCAGATCATTGCAGAGGAGCGCAAA
GCTAGCAGTCAGATGATGAAGACTTCGCTGCCGGAGTCGGTGGAGAAACC
GTCGACACCCCTCCCAGGTCGCAAATCCAAGATTCCCATACCCAAGCCTT
GCTGTATTTCGGCATCTGGAACTGATTCAATAAGTAGAGCGGGCTATGTA
CCAACTGCACCGTCACACCTCTCAGGAAGTGCCCAGCAGCCGTTAATAGC
ACGCACCCATGTGGTGGAAACAGAGATCAAGGTCAAGGAGATCTCCCCAC
CCAGTATACCTAAGACACCGGAACAAACTCAGCTCCATGCATCACCAACT
AAGGAGAAGAAAGCCAAGAACATATTTGATTTCCTGCGCAGAAACTTTGG
GCATCAGGAAGAGCCGCAGCATCATTCCACTCTGAATGAGACCCTTGAGA
AAAAGGTGGTGCTCACCAGCACCAAGAGTGGAGTAGATGTGGTCAATGCC
GATGAGTTTGTTCGGGTAGACAATTCAAAGTTCTATTTGGCAAGTGAGCT
GGAGGACGTACCAGTGCCACCTCCTCTGCCCAAGACACCTGCTCCTGTCA
ACATTGAGATTCGAAAAAAGATCACTACAAATGAGATATTAGAGGAAAAT
ACAACAGAACAGGCGTTAACCCAGGAAATAAGCGATTTGCTAGACGACGA
GATCATGAAACTGGAGAATTGACATCCCATAATCTACACGATTGGGTGTT
TAAAATTCCCCAGATTTCGGAGTGGTATGTGATCTCTCCAGCGCTTTTGC
GACACTAGAATAGCTCAGAAAATAACCAAGCTGTTCATCGACCTTAAATG
GCTCTCTCAAATTAATGTATATCGAAGTGGTACTTGAACATTTTACAATG
AAAATGATAATCAACGAATAATAATATCAATCGAATTTATTTTTACTATG
GTTTCCAATCTTTTTTGACATTACTCAGTTTTTGTTTACATTTTGTTATG
GGCTCAAGCTACGTAAGCTACAGTTTTTCTTTATTTAATTAAATACTTTA
CTAAACCCAAAAATTATGTACGAATAGAAAATTTGATTTTATATAAACAA
TTGTTAAACATATGTTTTATGGTTATATATTTTATACACAAACATACACA
CGAAAATAAAAGGTAAACCGTAAATTTGTCGCTCTAACACAGAAGTACAC
AGAAAGGATTAATAAAAAACCGCAAAAGCATACCAAATAAATTAAAGTAC
TATAAAAATTAATAATACAATCGAGATATAACTGTTGTTCAATTTTGTTA
ATAAACCTCAACTAAAATCGAAATCAAAAAAAAAAAAAAAAAA

FI05296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31531-RB 5907 CG31531-RB 37..5907 1..5871 29355 100 Plus
CG31531.a 5330 CG31531.a 94..5330 635..5871 26185 100 Plus
CG31531-RC 5544 CG31531-RC 311..5544 638..5871 26170 100 Plus
CG31531-RC 5544 CG31531-RC 19..311 1..293 1465 100 Plus
CG31531.a 5330 CG31531.a 19..94 1..76 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 526866..530970 1771..5875 20525 100 Plus
chr3R 27901430 chr3R 485310..486108 1..799 3995 100 Plus
chr3R 27901430 chr3R 522899..523251 912..1264 1765 100 Plus
chr3R 27901430 chr3R 523757..523964 1264..1471 1040 100 Plus
chr3R 27901430 chr3R 525878..526036 1613..1771 795 100 Plus
chr3R 27901430 chr3R 525426..525569 1472..1615 720 100 Plus
chr3R 27901430 chr3R 506486..506550 852..916 310 98.5 Plus
chr3R 27901430 chr3R 496505..496559 799..853 275 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RG 4119 CG43427-PG 1..4119 1154..5272 20595 100 Plus
CG43427-RF 4119 CG43427-PF 1..4119 1154..5272 20595 100 Plus
CG43427-RE 4119 CG43427-PE 1..4119 1154..5272 20595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RF 5897 CG43427-RF 23..5897 1..5875 29375 100 Plus
CG43427-RG 5552 CG43427-RG 315..5552 638..5875 26190 100 Plus
CG43427-RE 5335 CG43427-RE 98..5335 638..5875 26190 100 Plus
CG43427-RG 5552 CG43427-RG 23..315 1..293 1465 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PG 1372 CG43427-PG 1..1372 1154..5269 5289 100 Plus
CG43427-PF 1372 CG43427-PF 1..1372 1154..5269 5289 100 Plus
CG43427-PE 1372 CG43427-PE 1..1372 1154..5269 5289 100 Plus
CG43427-PH 1493 CG43427-PH 1..626 1154..3031 1989 99.7 Plus
CG43427-PN 648 CG43427-PN 1..625 1154..3028 1986 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4701157..4705263 1771..5877 20535 100 Plus
3R 32079331 3R 4659601..4660399 1..799 3995 100 Plus
3R 32079331 3R 4697190..4697542 912..1264 1765 100 Plus
3R 32079331 3R 4698048..4698255 1264..1471 1040 100 Plus
3R 32079331 3R 4700169..4700327 1613..1771 795 100 Plus
3R 32079331 3R 4699717..4699860 1472..1615 720 100 Plus
3R 32079331 3R 4680777..4680841 852..916 310 98.5 Plus
3R 32079331 3R 4670796..4670850 799..853 275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4441988..4446094 1771..5877 20535 100 Plus
3R 31820162 3R 4400432..4401230 1..799 3995 100 Plus
3R 31820162 3R 4438021..4438373 912..1264 1765 100 Plus
3R 31820162 3R 4438879..4439086 1264..1471 1040 100 Plus
3R 31820162 3R 4441000..4441158 1613..1771 795 100 Plus
3R 31820162 3R 4440548..4440691 1472..1615 720 100 Plus
3R 31820162 3R 4421608..4421672 852..916 310 98.4 Plus
3R 31820162 3R 4411627..4411681 799..853 275 100 Plus
Blast to na_te.dros performed 2014-11-26 21:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1011..1102 5536..5443 140 63.8 Minus
blood 7410 blood BLOOD 7410bp 1462..1710 5690..5448 139 56.9 Minus

FI05296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:31:44 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 526867..530970 1772..5875 100   Plus
chr3R 525880..526036 1615..1771 100 -> Plus
chr3R 525426..525568 1472..1614 100 -> Plus
chr3R 523758..523964 1265..1471 100 -> Plus
chr3R 522900..523251 913..1264 100 -> Plus
chr3R 506488..506546 854..912 100 -> Plus
chr3R 496506..496559 800..853 100 -> Plus
chr3R 485310..486108 1..799 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:43:29 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RC 1..4119 1154..5272 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:41 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RC 1..4119 1154..5272 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:24:32 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RE 1..4119 1154..5272 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:44 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RE 1..4119 1154..5272 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:43:29 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RB 1..5871 1..5871 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:40 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RB 1..5871 1..5871 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:24:32 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RF 23..5897 1..5875 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 09:26:52 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RB 1..5871 1..5871 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:44 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RF 23..5897 1..5875 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:44 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4701158..4705261 1772..5875 100   Plus
3R 4700171..4700327 1615..1771 100 -> Plus
3R 4699717..4699859 1472..1614 100 -> Plus
3R 4698049..4698255 1265..1471 100 -> Plus
3R 4697191..4697542 913..1264 100 -> Plus
3R 4680779..4680837 854..912 100 -> Plus
3R 4670797..4670850 800..853 100 -> Plus
3R 4659601..4660399 1..799 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:24:32 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 526880..530983 1772..5875 100   Plus
arm_3R 525893..526049 1615..1771 100 -> Plus
arm_3R 525439..525581 1472..1614 100 -> Plus
arm_3R 523771..523977 1265..1471 100 -> Plus
arm_3R 522913..523264 913..1264 100 -> Plus
arm_3R 506501..506559 854..912 100 -> Plus
arm_3R 496519..496572 800..853 100 -> Plus
arm_3R 485323..486121 1..799 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:27:46 Download gff for FI05296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4441989..4446092 1772..5875 100   Plus
3R 4441002..4441158 1615..1771 100 -> Plus
3R 4440548..4440690 1472..1614 100 -> Plus
3R 4438880..4439086 1265..1471 100 -> Plus
3R 4438022..4438373 913..1264 100 -> Plus
3R 4421610..4421668 854..912 100 -> Plus
3R 4411628..4411681 800..853 100 -> Plus
3R 4400432..4401230 1..799 100 -> Plus

FI05296.pep Sequence

Translation from 1153 to 5271

> FI05296.pep
MEATDQEVMLEGREDLMSTSATSSTNGGDTNGCGKKLSVTSPDPTPYVTK
QRVTRPTPPAPSKNPMQFVQIKPCNLYQTAQEQLKKAEEVKKLKEVKKEE
PEEWQNNLDNWKSSRRKRVEHIIDRAVETKKLELEEHDRLRRKSKTFTEM
MEERAERGGPRGRAKLASLAVYNEDETNDLSDLGIGTSSASGKSSLSGDY
DNNSVMSDHAAELDKAIGAASSVAAGVTAQNVDEQLNHINRNGSNGNHGN
GAAVGQTGPSNSSKSAGRQYISSPGYDTSSSNAQASSPDLCEYTYEGAIQ
DYKQRVQRASSNGNGNANGKLIGEHIAYPTRRGSKIEDRLSGFEVTSPSD
TQEGVEKQKVDVPKVDISKRKEIFEQAKAEVSNGGAPAAPKLVFRDGLTN
GNSATTAPKSEVRRLSGDISSIRDRMQSLEQQRKAFSSSKSVDVPVPPLK
QRLNSLQQSVAKEEQKKPPLVALIDARQLEIMRGEEERMRQQQQKEKHSP
SQTTLCAPKPAPPALIIEEPPVADTNDDSGIQEDTADELQQQQQLNAAIA
ALALEERQLEEAANAVNQIEAEFDELTDLHPSPLPPSPALPAVQQSLQQP
TVAQVPAQAVNQAAAPPLRDMEFSVSCTNNFIEPAKISPCDVNVVAASAV
SVSKSGPTPNPTSTPNMVSSSPNCNLRRKPSNEMVHHRNLLKMFKETFQN
DDDLKEVCEIVTSPGQFTQIIDFSKRPSNPPIPIPTLLPTSTPIPTQIPR
PLGKPPMSPKAVRLASSPKGHINPLSSPTNSGFSPPQFSINGRVEIFNSR
QLDKPPTPPAPPKKTVRSEHPLKEAVPSPEVVMCAPPMTIVDPDELPKPN
TVKALSNCFSQSDSKSLTSPIMSPKPLPSGRIPQITPPASPKPPKRVQLD
EVDRSSGDYAPVVGQTKAIVHTPPSKINARANQTLDPLAPNDSLCLHTSS
PSEIPSLKACSPNESSLFKLASSRPTSPSVDVASCQKFLNREAPKDIQLA
EEDRKRMDQFAVEEMPCDKIDVTKSPQPNTGFQIVTEDLVKKCDGKNISE
AVRDLDVPPSQEDIALCAGLLDCLAPAQEPICDSIDVRNGPVPATGFQDI
SEEEVKKCEKHNKNYVITNRPSSPIGSVRAAHSKALMDTCEQIIAEERKA
SSQMMKTSLPESVEKPSTPLPGRKSKIPIPKPCCISASGTDSISRAGYVP
TAPSHLSGSAQQPLIARTHVVETEIKVKEISPPSIPKTPEQTQLHASPTK
EKKAKNIFDFLRRNFGHQEEPQHHSTLNETLEKKVVLTSTKSGVDVVNAD
EFVRVDNSKFYLASELEDVPVPPPLPKTPAPVNIEIRKKITTNEILEENT
TEQALTQEISDLLDDEIMKLEN*

FI05296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18910-PA 1390 GF18910-PA 1..1381 1..1371 4536 77.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12562-PA 1369 GG12562-PA 1..1369 1..1372 5790 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19500-PA 1433 GH19500-PA 4..1420 2..1371 3879 63.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PG 1372 CG43427-PG 1..1372 1..1372 7065 100 Plus
CG43427-PF 1372 CG43427-PF 1..1372 1..1372 7065 100 Plus
CG43427-PE 1372 CG43427-PE 1..1372 1..1372 7065 100 Plus
CG43427-PH 1493 CG43427-PH 1..626 1..626 3171 99.7 Plus
CG43427-PP 1501 CG43427-PP 1..626 1..626 3171 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23771-PA 1449 GI23771-PA 4..1437 2..1370 3642 59.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22331-PA 1467 GL22331-PA 1..1458 1..1371 4003 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30203-PE 1485 GA30203-PE 1..1476 1..1371 4174 68 Plus
Dpse\GA30203-PD 734 GA30203-PD 1..623 1..580 1783 73.2 Plus
Dpse\GA30203-PF 1585 GA30203-PF 1..623 1..580 1778 73.2 Plus
Dpse\GA30203-PA 1625 GA30203-PA 1..623 1..580 1773 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10772-PA 1384 GM10772-PA 11..1383 1..1371 6111 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19746-PA 553 GD19746-PA 1..171 38..208 764 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23954-PA 1490 GJ23954-PA 4..1480 2..1371 3829 62.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12819-PA 1477 GK12819-PA 1..1468 1..1371 3930 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25433-PA 1323 GE25433-PA 1..1322 1..1371 5472 83.6 Plus

FI05296.hyp Sequence

Translation from 1153 to 5271

> FI05296.hyp
MEATDQEVMLEGREDLMSTSATSSTNGGDTNGCGKKLSVTSPDPTPYVTK
QRVTRPTPPAPSKNPMQFVQIKPCNLYQTAQEQLKKAEEVKKLKEVKKEE
PEEWQNNLDNWKSSRRKRVEHIIDRAVETKKLELEEHDRLRRKSKTFTEM
MEERAERGGPRGRAKLASLAVYNEDETNDLSDLGIGTSSASGKSSLSGDY
DNNSVMSDHAAELDKAIGAASSVAAGVTAQNVDEQLNHINRNGSNGNHGN
GAAVGQTGPSNSSKSAGRQYISSPGYDTSSSNAQASSPDLCEYTYEGAIQ
DYKQRVQRASSNGNGNANGKLIGEHIAYPTRRGSKIEDRLSGFEVTSPSD
TQEGVEKQKVDVPKVDISKRKEIFEQAKAEVSNGGAPAAPKLVFRDGLTN
GNSATTAPKSEVRRLSGDISSIRDRMQSLEQQRKAFSSSKSVDVPVPPLK
QRLNSLQQSVAKEEQKKPPLVALIDARQLEIMRGEEERMRQQQQKEKHSP
SQTTLCAPKPAPPALIIEEPPVADTNDDSGIQEDTADELQQQQQLNAAIA
ALALEERQLEEAANAVNQIEAEFDELTDLHPSPLPPSPALPAVQQSLQQP
TVAQVPAQAVNQAAAPPLRDMEFSVSCTNNFIEPAKISPCDVNVVAASAV
SVSKSGPTPNPTSTPNMVSSSPNCNLRRKPSNEMVHHRNLLKMFKETFQN
DDDLKEVCEIVTSPGQFTQIIDFSKRPSNPPIPIPTLLPTSTPIPTQIPR
PLGKPPMSPKAVRLASSPKGHINPLSSPTNSGFSPPQFSINGRVEIFNSR
QLDKPPTPPAPPKKTVRSEHPLKEAVPSPEVVMCAPPMTIVDPDELPKPN
TVKALSNCFSQSDSKSLTSPIMSPKPLPSGRIPQITPPASPKPPKRVQLD
EVDRSSGDYAPVVGQTKAIVHTPPSKINARANQTLDPLAPNDSLCLHTSS
PSEIPSLKACSPNESSLFKLASSRPTSPSVDVASCQKFLNREAPKDIQLA
EEDRKRMDQFAVEEMPCDKIDVTKSPQPNTGFQIVTEDLVKKCDGKNISE
AVRDLDVPPSQEDIALCAGLLDCLAPAQEPICDSIDVRNGPVPATGFQDI
SEEEVKKCEKHNKNYVITNRPSSPIGSVRAAHSKALMDTCEQIIAEERKA
SSQMMKTSLPESVEKPSTPLPGRKSKIPIPKPCCISASGTDSISRAGYVP
TAPSHLSGSAQQPLIARTHVVETEIKVKEISPPSIPKTPEQTQLHASPTK
EKKAKNIFDFLRRNFGHQEEPQHHSTLNETLEKKVVLTSTKSGVDVVNAD
EFVRVDNSKFYLASELEDVPVPPPLPKTPAPVNIEIRKKITTNEILEENT
TEQALTQEISDLLDDEIMKLEN*

FI05296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PG 1372 CG43427-PG 1..1372 1..1372 7065 100 Plus
CG43427-PF 1372 CG43427-PF 1..1372 1..1372 7065 100 Plus
CG43427-PE 1372 CG43427-PE 1..1372 1..1372 7065 100 Plus
CG43427-PH 1493 CG43427-PH 1..626 1..626 3171 99.7 Plus
CG43427-PP 1501 CG43427-PP 1..626 1..626 3171 99.7 Plus