Clone FI05332 Report

Search the DGRC for FI05332

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:53
Well:32
Vector:pOT2
Associated Gene/Transcriptl(3)72Dn-RA
Protein status:FI05332.pep: gold
Sequenced Size:2305

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5018 2008-12-18 5.12 accounting

Clone Sequence Records

FI05332.complete Sequence

2305 bp assembled on 2008-08-28

GenBank Submission: BT044216.1

> FI05332.complete
ATTTTGTTTCAGTTGTTGTTCCTTATTTCTTCTTAACTAAATAATTGTAT
TAACTAAATAAAATGACGAATAATGCGAAGAAGGAACCCCAGCAAAGGGG
CAAGCATCAGGTGCATAATGTGCGCTTCTACACTATAAAGCCGCGTGAAA
TTGTCAGCTTGGCGTATAGTAAATCGAGCAAGTGCCTCGCTCTGAGTCGT
GCAACACCCGTCATTGAGCTATGGAACCTGGAGCACGCCCCGTATTTGGA
TCGTGTAATCCACCTGCCCACCGATTCTCATGTGGAATCTATAGCCTGGG
CGGGAAACCGCTTATTTTCCGTGGATTTAAGTGGTAAACTGATCGAGTGG
GATGTGATTAAGCTAAAACAACGATATGAGCACTCGCCCACTGGCAATGC
TCTCTGGAGTATCGATGTGAATCCCGCGGAAACGGATATTGCCATTGGCT
CAGAGGAAGGGCACATCAACATCCTGAGTATTGAGAATGACGAAATCACC
TATAAATCCCTATTTAACAAGCAAAAAGGTCGCGTTCTCTGCATCAAGTT
TGATAAGACTGGAACTAAACTGGTGACCGGCACTGAGGGATTTGTTCGCA
TTTGGAACGTCCTCAAGGGAACCACTCTGCACACGATGACCCTATCCGAA
AAGAACGTAATAGTTTGGTCCCTGCAGGTGCTATCCGATAATACGATTAT
TGCCGGTGATTCAGCGGGATTTGTTACCGTTTGGGATGCGGATAACGCGA
CACAGATAGATTCCACACGAGTTCTGGATAAAAACGTATTTGCCCTGGCT
GTGAATAATAAGGAGGATCGATTAGTTTGCAGTGGAATGCAGCCGCCGCT
CATCCGGATTTTCAGCAAAACCAAGATAAAGCGGGAAGAGTCCACCAGCG
AGCGTTGGATTAAATTCCTACAGCGCGATGCCCACAAACACTATGTGAAA
TCCCTGTTGGTTATCGACGATCAAATTTATTCGGGAGGCAGGGATGGCAT
ATTGACCATTACGTCCAGTGAACGAATGCAGGCACATTTGTCGCAGCATG
CTCCCTTTCTGAAAGGTTCCGTAGCTTCCATGGCAATCAGTAAAAAGCTT
TTGCTTTTGCGATATCCCAACAGCGTGCACCTGTGGCGCTTGGGTTCTGT
GGCCCCGCAAGGCGAGGACAAGAAGAAACCCTGGGCACTGCCCGTCGGCC
ACACGGAGGAACAACTTCTGGAGCTGCCACCCCAGAAACTTCTCCAACTA
AATGTCAAAGAGCACAACTTTATACAGTCTGCTGCCATTTCATCAGATGC
AAACTGGATTTGCTACTCTACCTTAAAGGAACTCCGAATCAGTCGTTTGA
AAAGTGATCCCCTGCAGGTGGAGCGTCTGGTAGACGATCTTCCCGAGGAA
CTTCAACCAGCCAGTCATATAATTTTCACAAAGCAGGGAGATCTAGTGCT
GCTCAACCCGCAGAACAATCATCTAAGTTGGTTTACTTTAGAGGAAGATC
TGGTTACATTCAAATATACCATCGATTTGAGTGAGAAGTGTAAGAATACG
ATTAGCCACGTGGTTATCTCTTCGCATGGCGAATACATTGTGGCTGCGAG
CTCAGACCACATAATATCAGTTTGGAAACTACATGGAAAACAATACAAGC
ACCTGCTGAACCTACCAAGACACCGAGCAGGTACCACCGCCCTATCCATG
CACGAGGATTACCCACGCGTGGTGGTCGCCTACGCCAATGGCCAGCTGGT
GGAGTACGATTTGGTCAATCGGATATTCACCTGTGAAACTAATGAGTACC
TGATACCCGAGACCAGGCGCCATTGCATCAATGGAATCAGCCTGGATCCA
CAAAATCGTAATATATTTATTGTTCACACCGAGGGCAATTTGTATGTGTT
GGAGAGGGATCAGCATCTGGATCCCAAAGAGCTTGTGAGCAACAGCAAGT
CTAAAAAGTTATCAAATGGAAACCGCTCTTCAGTTGATGGCGGCTCAAAA
GGCCTGAGCCTCAAGACGACTCTGTCACGACAGCACCTGGTGCACGTGTC
TCGCCTGAGCCCTAACGAACTTGTCAACGTCAGCATTTCGACAAACAATC
TGTTGGCTCCGCTGCCGCCGCCGTACCAGCGGAAGAAGTTCGGTGCCTCG
TAAATGGAGCGCCGCAGGATGAAGTTGAAGTGGAGTGGAGTGGCGAAGCT
CCAGCATCACTTTGGCTTACCCAGTAGTTTCCACTTAGTTACCAAATAAA
ATCAAAAGTATAAAACAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

FI05332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5018-RA 2308 CG5018-RA 39..2306 1..2268 11340 100 Plus
CG5018.a 2285 CG5018.a 7..2039 1..2033 10165 100 Plus
CG5018.a 2285 CG5018.a 2048..2283 2033..2268 1180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:00:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16216271..16218105 2033..199 9130 99.8 Minus
chr3L 24539361 chr3L 16215808..16216045 2268..2031 1190 100 Minus
chr3L 24539361 chr3L 16218175..16218373 199..1 995 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-RA 2091 CG5018-PA 1..2091 63..2153 10455 100 Plus
l(3)72Dn-RB 2100 CG5018-PB 1..2100 63..2153 10330 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-RA 2314 CG5018-RA 49..2314 1..2266 11330 100 Plus
l(3)72Dn-RB 2323 CG5018-RB 49..2323 1..2266 11205 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-PA 696 CG5018-PA 1..696 63..2150 3440 100 Plus
l(3)72Dn-PB 699 CG5018-PB 1..699 63..2150 3426 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16226587..16228421 2033..199 9175 100 Minus
3L 28110227 3L 16226124..16226361 2268..2031 1190 100 Minus
3L 28110227 3L 16228491..16228689 199..1 995 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16219687..16221521 2033..199 9175 100 Minus
3L 28103327 3L 16219224..16219461 2268..2031 1190 100 Minus
3L 28103327 3L 16221591..16221789 199..1 995 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:00:40 has no hits.

FI05332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:21:40 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16218175..16218373 1..199 100   Minus
chr3L 16216271..16218104 200..2033 99 <- Minus
chr3L 16215804..16216042 2034..2273 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:28 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2091 63..2153 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:53 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2091 63..2153 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:30 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 1..2091 63..2153 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:58 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2091 63..2153 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:40 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 1..2091 63..2153 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:20 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2270 1..2270 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:53 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2270 1..2270 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:30 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 49..2314 1..2266 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:06:33 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 1..2270 1..2270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:40 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 49..2314 1..2266 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:21:40 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16228491..16228689 1..199 100   Minus
3L 16226587..16228420 200..2033 100 <- Minus
3L 16226120..16226358 2034..2273 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:30 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16221591..16221789 1..199 100   Minus
arm_3L 16219687..16221520 200..2033 100 <- Minus
arm_3L 16219220..16219458 2034..2273 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:14 Download gff for FI05332.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16221591..16221789 1..199 100   Minus
3L 16219687..16221520 200..2033 100 <- Minus
3L 16219220..16219458 2034..2273 98 <- Minus

FI05332.pep Sequence

Translation from 62 to 2152

> FI05332.pep
MTNNAKKEPQQRGKHQVHNVRFYTIKPREIVSLAYSKSSKCLALSRATPV
IELWNLEHAPYLDRVIHLPTDSHVESIAWAGNRLFSVDLSGKLIEWDVIK
LKQRYEHSPTGNALWSIDVNPAETDIAIGSEEGHINILSIENDEITYKSL
FNKQKGRVLCIKFDKTGTKLVTGTEGFVRIWNVLKGTTLHTMTLSEKNVI
VWSLQVLSDNTIIAGDSAGFVTVWDADNATQIDSTRVLDKNVFALAVNNK
EDRLVCSGMQPPLIRIFSKTKIKREESTSERWIKFLQRDAHKHYVKSLLV
IDDQIYSGGRDGILTITSSERMQAHLSQHAPFLKGSVASMAISKKLLLLR
YPNSVHLWRLGSVAPQGEDKKKPWALPVGHTEEQLLELPPQKLLQLNVKE
HNFIQSAAISSDANWICYSTLKELRISRLKSDPLQVERLVDDLPEELQPA
SHIIFTKQGDLVLLNPQNNHLSWFTLEEDLVTFKYTIDLSEKCKNTISHV
VISSHGEYIVAASSDHIISVWKLHGKQYKHLLNLPRHRAGTTALSMHEDY
PRVVVAYANGQLVEYDLVNRIFTCETNEYLIPETRRHCINGISLDPQNRN
IFIVHTEGNLYVLERDQHLDPKELVSNSKSKKLSNGNRSSVDGGSKGLSL
KTTLSRQHLVHVSRLSPNELVNVSISTNNLLAPLPPPYQRKKFGAS*

FI05332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10315-PA 696 GF10315-PA 1..696 1..696 2961 78.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13488-PA 696 GG13488-PA 1..696 1..696 3333 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15625-PA 693 GH15625-PA 1..693 1..696 2137 59 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-PA 696 CG5018-PA 1..696 1..696 3615 100 Plus
l(3)72Dn-PB 699 CG5018-PB 1..699 1..696 3601 99.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12673-PA 612 GI12673-PA 11..607 13..611 1870 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18028-PA 738 GL18028-PA 1..738 1..696 2431 64.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18598-PA 703 GA18598-PA 1..703 1..696 2559 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24438-PA 695 GM24438-PA 1..695 1..696 3501 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12505-PA 696 GD12505-PA 1..696 1..696 3529 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12653-PA 698 GJ12653-PA 11..698 13..696 2126 59.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24556-PA 697 GK24556-PA 1..697 1..696 2068 57.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22581-PA 696 GE22581-PA 1..696 1..696 3289 90.5 Plus

FI05332.hyp Sequence

Translation from 62 to 2152

> FI05332.hyp
MTNNAKKEPQQRGKHQVHNVRFYTIKPREIVSLAYSKSSKCLALSRATPV
IELWNLEHAPYLDRVIHLPTDSHVESIAWAGNRLFSVDLSGKLIEWDVIK
LKQRYEHSPTGNALWSIDVNPAETDIAIGSEEGHINILSIENDEITYKSL
FNKQKGRVLCIKFDKTGTKLVTGTEGFVRIWNVLKGTTLHTMTLSEKNVI
VWSLQVLSDNTIIAGDSAGFVTVWDADNATQIDSTRVLDKNVFALAVNNK
EDRLVCSGMQPPLIRIFSKTKIKREESTSERWIKFLQRDAHKHYVKSLLV
IDDQIYSGGRDGILTITSSERMQAHLSQHAPFLKGSVASMAISKKLLLLR
YPNSVHLWRLGSVAPQGEDKKKPWALPVGHTEEQLLELPPQKLLQLNVKE
HNFIQSAAISSDANWICYSTLKELRISRLKSDPLQVERLVDDLPEELQPA
SHIIFTKQGDLVLLNPQNNHLSWFTLEEDLVTFKYTIDLSEKCKNTISHV
VISSHGEYIVAASSDHIISVWKLHGKQYKHLLNLPRHRAGTTALSMHEDY
PRVVVAYANGQLVEYDLVNRIFTCETNEYLIPETRRHCINGISLDPQNRN
IFIVHTEGNLYVLERDQHLDPKELVSNSKSKKLSNGNRSSVDGGSKGLSL
KTTLSRQHLVHVSRLSPNELVNVSISTNNLLAPLPPPYQRKKFGAS*

FI05332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-PA 696 CG5018-PA 1..696 1..696 3615 100 Plus
l(3)72Dn-PB 699 CG5018-PB 1..699 1..696 3601 99.6 Plus