Clone FI05344 Report

Search the DGRC for FI05344

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:53
Well:44
Vector:pOT2
Associated Gene/TranscriptCG6621-RA
Protein status:FI05344.pep: gold
Sequenced Size:3059

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6621 2008-08-15 Release 5.9 accounting
CG6621 2008-12-18 5.12 accounting

Clone Sequence Records

FI05344.complete Sequence

3059 bp assembled on 2008-07-17

GenBank Submission: BT044217.1

> FI05344.complete
CAGAAATTCAATCAGGAAATCCTTTTGTTAATGCCTGCTATACTCATAAC
AAGACCATTAATTGTGTAGCGTTTAAGGAAAACCGAAAGAGTGAGCTGCT
TCACTTGCCCCGAGTGACTGGAAATCTAATTTGCGTTTATTTTGACGCAA
AACCGGTGCCGACATTTTCTCGCCCAATTAAATTGAGTGTGGATTTTGCC
GCATCCCGTTCCCTTTGCCCTTTAAAAAACCTTGATCTTTAAATGTTGTA
AAGCAAAGTGGTGCGCGCTGCCAAGATGAACTTCGATTACATCGGCCAGG
CCCTGGGCTACCACGGGCAGCCGCTCCAGAAGATCTGGGACGACGAGCGC
GGCGTGGACGACCTGCGGCTGATGGGACTCACCCAGGTGAACTACGGGGT
CTACCAGGAGCGGCAGAAGTACTTCACCTTCCAGGAGCGGGCTAAGCGAT
TGAAGATGCACCAGTTTCTGGCCAGGAAGGCCACCGATTTGTATGATCGC
ACGCTGGTGGCCAATGTTATGGAGGATTCCCTGCTGGCACAAGGCAACAC
ATACATGACTCAGATGGCCCCCTTCGAGTTCTTCCTCAATGTGAAGGACA
AACGCAAGGGATGGGCGCACCGATTGTCTGCACTGAAGCAGGGCGACATC
ATCTACACGCAGGTGACACGGCTGGCCAGCGGCAACCGGCTCATAGTGAA
GCCACTCTGCACTGCTGAGCCCAAACACGCCTACTTGGCTGACATTCCCA
TAAAGGCCGTGATCCTGCAGGACTTCTGGGGTCCCTTGCCCCTGGACAAG
CAGGGCAATCCGCGCAGCTTTGTCCAGAATGACATCTTGCGCTGTGAGAT
AAACAACATATCCGCGGATACCGAGCGGCTCTCTCTGAACATGATCGGCA
TGTTCAATAAGGTGCCGGATTTAAAGTTTGGTCTCTGCGACTTTAAGGAG
TTGCCCAAGTATTATAGTAAAATACATAACCTGGATCATCCATCTGCGTC
TCACTACGAGGATGAGCTAAACAAAGCCTTAGAGTTTGAAAATCCCAACT
ACGATTTGCTGTTCCAAATGAACGGACTGCAGCCAAACGAGAATCTGTCA
CTGATGTCATATTTAAGGGCGGGATTCCCGGAGGAGGAGAACGCCGCGGA
GTTGCGACAGAAGCAGGCCTCCCAGTGGGCCTTCCGCTCCGTGGCTGATG
GCATCGAACACTTTAAGAACGGCCAACAGGTCGAGGCCTTTCAGTGCCTG
AACAAGGCCTTAAACATTGATCCGCGCAATGTTGAGGCGCTGGTGGCCCG
CGGTGCCCTCTACGCGAATCGCGGCAGCTTTCTTAAAGGGCTGCAGGACT
TTGAGAAGGCTCTGCACCTGAACAAGTATCACGTGAACGCGCGCAAATAC
ATGGGCGAAACGCTGGTGGCTCTGGGTCGCAGCTACGAAGAGGAGAATCG
CATAGCCGAAGCCGTCAAGGCCTATAGCGATTGCCTAAATCTGTTGCCGC
TGCACGAAGAAGCACGCCAGTCCCTGGACGCACTGCATCGAAGTGGAGAC
GGTAAGCGTAGAATAAGCACTGAGCCGTCGAACATGACCGGTGGCCAGTC
CTCGGACGAGTCCTCCTCATCGAGTGCCAGTGATAGTGAATGCGAAGATT
CGGCTGGTAAGCCCAAGTCAAACATTAGTCAGCCCTTTTATGCCCAACAC
AAGCTAAAGCAATCGGGAGATGAAAAGTTGGCCGTCATTGATGCCCATAA
GGCCAATGAGTTCCGTTTGGACGACGACGAGACCGTGTCGAGTGTGCGGA
AGCTTTTGCGCGAGGCGAGCAAACACAAGAAGGCCAAGAAGAAGGGAAAG
AAGAAAAAGGACAAGAAGGAGCGAAGGAGGTCCAGGACCAAGTCCGAAAC
GGAGGATCCCATTGAATTGCTTAAGAAGATCGACTTCCAGGAGGCCCTCA
GACAAGACAACAAGCTCATGAACAGCACCAGGAGCGATGAGGAACGCAAG
GCCAAGATCAAGAGCTATCTAAAAGAAGGAGGAAAAGAGTCACCACCTCC
CCCGCCACCAATGAAAAAAACAGCAGTCTCATCTAGAAAGTCAAGCTTTG
ACAATGTGGGACCCAGCACATCGCGTCATGCGGCCTCCGTTGTTGGCTTT
GGAGGCGCCCAGCCACCACCAGCGCCCAAGTTTCTGGGGCAAAAGAAACA
TCCGGAGCCGGCACCCAAGCTCTCCTTTCAGATTAAGAAACGACCGCTGC
AGATGGACAAGCTGGGAATGCTGCGTCTAGCAGCGCCAGCGGAGCCACTC
AAGGGAGGACGGAGCAGCAGCTCCCGCAGCCGGAGTAGGAGTAGAAGCCG
CTCGCGAAGTCGCTCACGTAATCGTCGGCTTGGAAGGAGCACGCGTTCGT
CGCTCAGGAGCCGGCGTTCTGGCTCGAGGTCCAGATCGATTAGCCGATCA
CGGTCGCGTCGCCGACGTACCTACTCCCGTTCGCGCAGCCCCTCGCCACG
CAGTTACGGAAATCGCTTTGTGATTGGACGCTACCGTAATCGCCGAACTC
GGCGTTCGCGCTCCTTTCATCGTCGGCGTTCTCCATCGCCCATTTTGAAA
CGCCGATCGCCTTCACCATTTGTGCCCCGTCGCACACCATCGCCGGCATC
CCGCTATCGACGCAGCCGATCCCGCAGTCGCTCCCGCTCACGCAGTCGGA
GTCCTCGACGCTTTCAGTCTCGCTACATGCCGAGGGATCGTGGCTCCGTG
AATCGAAGCAGGTACTCCTGGCACAATCCCCATAAACGCAGTGTATCACG
CACCGTGGAGCCAAATGGCAAAGATGAAAGGGCAGCTACTCCGCCGAAAA
AGGGTGTTGCTGATGATAGATCTGGACGAGAAGAAAGGGCGTAAACAGGG
CCTCGCCTACGAGTCTTAAGTTTCCTTTTAGCTGATAGGGTACATTTGAT
TTGATATTCAAATTTGTAAAACGCTCCCTTTGGGAATTGTTCATTGGTCA
CTAAATAAAGAAGCTTGCGAAGCGAATTTATTACAAACTATAAAAAAAAA
AAAAAAAAA

FI05344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-RA 3120 CG6621-RA 74..3116 1..3043 15215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6715305..6716382 3041..1964 5375 99.9 Minus
chr3R 27901430 chr3R 6718451..6718994 544..1 2720 100 Minus
chr3R 27901430 chr3R 6717051..6717518 1653..1186 2340 100 Minus
chr3R 27901430 chr3R 6716631..6716929 1951..1653 1495 100 Minus
chr3R 27901430 chr3R 6717622..6717843 1186..965 1110 100 Minus
chr3R 27901430 chr3R 6718176..6718390 756..542 1075 100 Minus
chr3R 27901430 chr3R 6717900..6718113 967..754 1070 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-RA 2619 CG6621-PA 1..2619 276..2894 13095 100 Plus
CG6621-RB 2607 CG6621-PB 1..2607 276..2894 12880 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-RA 3115 CG6621-RA 75..3115 1..3041 15205 100 Plus
CG6621-RB 3103 CG6621-RB 75..3103 1..3041 14990 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-PA 872 CG6621-PA 1..676 276..2303 3208 100 Plus
CG6621-PB 868 CG6621-PB 1..672 276..2303 3171 99.4 Plus
CG6621-PA 872 CG6621-PA 772..872 2589..2891 332 100 Plus
CG6621-PB 868 CG6621-PB 768..868 2589..2891 332 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10889766..10890845 3043..1964 5400 100 Minus
3R 32079331 3R 10892914..10893457 544..1 2720 100 Minus
3R 32079331 3R 10891514..10891981 1653..1186 2340 100 Minus
3R 32079331 3R 10891094..10891392 1951..1653 1495 100 Minus
3R 32079331 3R 10892085..10892306 1186..965 1110 100 Minus
3R 32079331 3R 10892639..10892853 756..542 1075 100 Minus
3R 32079331 3R 10892363..10892576 967..754 1070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10630597..10631676 3043..1964 5400 100 Minus
3R 31820162 3R 10633745..10634288 544..1 2720 100 Minus
3R 31820162 3R 10632345..10632812 1653..1186 2340 100 Minus
3R 31820162 3R 10631925..10632223 1951..1653 1495 100 Minus
3R 31820162 3R 10632916..10633137 1186..965 1110 100 Minus
3R 31820162 3R 10633470..10633684 756..542 1075 100 Minus
3R 31820162 3R 10633194..10633407 967..754 1070 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:06:30 has no hits.

FI05344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:28:14 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6718452..6718994 1..543 100   Minus
chr3R 6718177..6718388 544..755 100 <- Minus
chr3R 6717900..6718111 756..967 100 <- Minus
chr3R 6717622..6717840 968..1186 100 <- Minus
chr3R 6717051..6717517 1187..1653 100 <- Minus
chr3R 6716619..6716928 1654..1963 82 <- Minus
chr3R 6715305..6716382 1964..3041 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:36 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 1..2619 276..2894 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:20 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 1..2619 276..2894 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:15 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 1..2619 276..2894 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:45 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 1..2619 276..2894 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:14 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 1..2619 276..2894 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:45 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 74..3114 1..3041 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:20 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 74..3114 1..3041 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:15 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 75..3115 1..3041 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:46 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 74..3114 1..3041 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:14 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 75..3115 1..3041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:28:14 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10892915..10893457 1..543 100   Minus
3R 10892640..10892851 544..755 100 <- Minus
3R 10892363..10892574 756..967 100 <- Minus
3R 10892085..10892303 968..1186 100 <- Minus
3R 10891514..10891980 1187..1653 100 <- Minus
3R 10891082..10891391 1654..1963 97 <- Minus
3R 10889768..10890845 1964..3041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:15 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6718637..6719179 1..543 100   Minus
arm_3R 6718362..6718573 544..755 100 <- Minus
arm_3R 6718085..6718296 756..967 100 <- Minus
arm_3R 6717807..6718025 968..1186 100 <- Minus
arm_3R 6717236..6717702 1187..1653 100 <- Minus
arm_3R 6716804..6717113 1654..1963 97 <- Minus
arm_3R 6715490..6716567 1964..3041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:18 Download gff for FI05344.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10633746..10634288 1..543 100   Minus
3R 10633471..10633682 544..755 100 <- Minus
3R 10633194..10633405 756..967 100 <- Minus
3R 10632916..10633134 968..1186 100 <- Minus
3R 10632345..10632811 1187..1653 100 <- Minus
3R 10631913..10632222 1654..1963 97 <- Minus
3R 10630599..10631676 1964..3041 100 <- Minus

FI05344.pep Sequence

Translation from 275 to 2893

> FI05344.pep
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYF
TFQERAKRLKMHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPF
EFFLNVKDKRKGWAHRLSALKQGDIIYTQVTRLASGNRLIVKPLCTAEPK
HAYLADIPIKAVILQDFWGPLPLDKQGNPRSFVQNDILRCEINNISADTE
RLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPSASHYEDELNK
ALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRG
SFLKGLQDFEKALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAY
SDCLNLLPLHEEARQSLDALHRSGDGKRRISTEPSNMTGGQSSDESSSSS
ASDSECEDSAGKPKSNISQPFYAQHKLKQSGDEKLAVIDAHKANEFRLDD
DETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKSETEDPIELLK
KIDFQEALRQDNKLMNSTRSDEERKAKIKSYLKEGGKESPPPPPPMKKTA
VSSRKSSFDNVGPSTSRHAASVVGFGGAQPPPAPKFLGQKKHPEPAPKLS
FQIKKRPLQMDKLGMLRLAAPAEPLKGGRSSSSRSRSRSRSRSRSRSRNR
RLGRSTRSSLRSRRSGSRSRSISRSRSRRRRTYSRSRSPSPRSYGNRFVI
GRYRNRRTRRSRSFHRRRSPSPILKRRSPSPFVPRRTPSPASRYRRSRSR
SRSRSRSRSPRRFQSRYMPRDRGSVNRSRYSWHNPHKRSVSRTVEPNGKD
ERAATPPKKGVADDRSGREERA*

FI05344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18266-PA 911 GF18266-PA 1..678 1..673 2475 73.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17251-PA 916 GG17251-PA 1..874 1..864 3276 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19427-PA 945 GH19427-PA 1..714 1..671 1977 59.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-PA 872 CG6621-PA 1..872 1..872 4507 100 Plus
CG6621-PB 868 CG6621-PB 1..868 1..872 4470 99.5 Plus
CG6695-PB 715 CG6695-PB 255..546 526..812 222 32.4 Plus
CG6695-PA 961 CG6695-PA 255..546 526..812 222 32.4 Plus
Srp54-PA 513 CG4602-PA 268..451 668..870 212 36.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22632-PA 933 GI22632-PA 1..688 1..671 2027 62.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12055-PA 966 GL12055-PA 1..719 1..671 2091 61.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19731-PB 966 GA19731-PB 1..719 1..671 2087 61.7 Plus
Dpse\GA19731-PA 950 GA19731-PA 1..703 1..671 2084 62.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26135-PA 872 GM26135-PA 1..872 1..872 3680 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20689-PA 877 GD20689-PA 1..877 1..872 3478 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23878-PA 943 GJ23878-PA 1..701 1..671 2071 61.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13280-PA 958 GK13280-PA 1..815 1..794 2094 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24652-PA 921 GE24652-PA 1..879 1..864 3282 86 Plus

FI05344.hyp Sequence

Translation from 275 to 1954

> FI05344.hyp
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYF
TFQERAKRLKMHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPF
EFFLNVKDKRKGWAHRLSALKQGDIIYTQVTRLASGNRLIVKPLCTAEPK
HAYLADIPIKAVILQDFWGPLPLDKQGNPRSFVQNDILRCEINNISADTE
RLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPSASHYEDELNK
ALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRG
SFLKGLQDFEKALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAY
SDCLNLLPLHEEARQSLDALHRSGDGKRRISTEPSNMTGGQSSDESSSSS
ASDSECEDSAGKPKSNISQPFYAQHKLKQSGDEKLAVIDAHKANEFRLDD
DETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKSETEDPIELLK
KIDFQEALR*

FI05344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-PB 868 CG6621-PB 1..559 1..559 2903 100 Plus
CG6621-PA 872 CG6621-PA 1..559 1..559 2903 100 Plus