Clone FI05365 Report

Search the DGRC for FI05365

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:53
Well:65
Vector:pOT2
Associated Gene/TranscripteIF-4E-RB
Protein status:FI05365.pep: gold
Sequenced Size:1718

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
eIF-4E 2008-08-15 Release 5.9 accounting
eIF-4E 2008-12-18 5.12 accounting

Clone Sequence Records

FI05365.complete Sequence

1718 bp assembled on 2008-08-14

GenBank Submission: BT044219.1

> FI05365.complete
CCACACTGTCTGGCCACCAAAATCCCAAACTTAATTAAAGAATTAAATAA
TTCGAATAATAATTAAGCCCAGTAACCTACGCAGCTTGAGTGCGTAACCG
ATATCTAGTATACATTTCGATACATCGAAATCATGGTAGTGTTGGAGACG
GAGAAGGCAATCTGTGTTTTTATGTCAGATACGTGCGCGTGTGTGTGTGT
GCTGTAATTCCATCGCCCCTTTCGATTCCGAGTTCGTTAGGAACAGCATT
AGTTCGCCTATTTTAGTAGTAGCCTAGTCCGATTTTAAGTGAAACAGGAT
ACTCCAACACCATATACTCAATAATTAGTTACAACACCCACTCAACCATA
CAGCAACAACAAGTTTAACGAGTTTTTTGTATTATCATTACTTAGTTTTT
TGGTTAATAATACACAAGTGAAGAGCGAACTGCAGGGGAGCGAGATATCA
CGAAACAATCCAAAATCCACACACACTCAAACAGAAATCAAAAGCTTCGC
TCTCTCGCACACACACGCACCAACCAACTATCAACTATCACAAACACCGC
GACAGAGAGAGAGCGGCAAGTGAATCACGGCGAATCGAAACCGATCCGAA
CCCACTCCGGAGCCGAAAAAGAACTGATCCTACCATCAAACGCATCCAAT
AAACACGGCCGCCAACATGCAGAGCGACTTTCACAGAATGAAGAACTTTG
CCAATCCCAAGTCCATGTTCAAAACCAGCGCCCCCAGCACCGAGCAGGGT
CGTCCGGAACCACCAACTTCGGCTGCAGCGCCCGCCGAGGCTAAGGATGT
CAAGCCCAAGGAGGACCCACAGGAGACTGGTGAACCAGCAGGCAACACTG
CAACCACTACTGCTCCTGCCGGCGACGATGCTGTGCGCACCGAGCATTTA
TACAAACACCCGCTCATGAATGTCTGGACGCTGTGGTACCTTGAAAACGA
TCGGTCCAAGTCCTGGGAGGACATGCAAAACGAGATCACCAGCTTCGATA
CCGTCGAGGACTTCTGGAGCCTATACAACCACATCAAGCCCCCATCAGAG
ATCAAGCTGGGTAGTGACTACTCGCTATTCAAGAAGAACATTCGTCCCAT
GTGGGAGGATGCAGCCAACAAACAGGGCGGTCGTTGGGTAATTACCCTTA
ACAAAAGCTCCAAGACCGATCTGGATAACCTATGGCTCGATGTGCTGCTC
TGCCTGATTGGTGAGGCCTTCGATCACTCCGATCAGATCTGCGGCGCTGT
TATAAACATTCGCGGCAAGAGCAACAAGATATCCATCTGGACTGCCGACG
GAAACAACGAGGAAGCTGCCCTTGAGATTGGTCACAAGCTGCGCGATGCC
TTGCGTCTGGGACGCAACAACTCGCTGCAGTATCAGTTGCACAAGGACAC
GATGGTCAAGCAGGGCTCCAACGTGAAATCGATCTACACTTTGTAGGCGG
CTAATAACTGGCCGCTCCTTATTCGGTCCGATCCCACACAGATTATTTTG
TCTTTCATTTATTTATCGTTATAAGCAACAGTAGCGATTAATCGTGACTA
TTGTCCAAGACCCGCGTAACGAAACCGAAACGGAACCCCCTTTGTTATCA
AAAATCGGCATAATATAAAATCTATCTGCTTTTTGTAATCACTGTCAATA
ATGGATTAGACGGAAAAGTATATTAATAAAAACCTACATTAAAACCGGAA
AAAAAAAAAAAAAAAAAA

FI05365.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RD 1851 eIF-4E-RD 109..1807 1..1699 8390 99.5 Plus
eIF-4E-RB 1603 eIF-4E-RB 254..1559 394..1699 6425 99.4 Plus
eIF-4E-RE 1571 eIF-4E-RE 262..1565 396..1699 6415 99.4 Plus
eIF-4E-RB 1603 eIF-4E-RB 100..255 1..156 780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9392937..9393505 723..155 2845 100 Minus
chr3L 24539361 chr3L 9391515..9391930 1698..1283 2080 100 Minus
chr3L 24539361 chr3L 9392480..9392850 1094..724 1855 100 Minus
chr3L 24539361 chr3L 9394187..9394343 157..1 785 100 Minus
chr3L 24539361 chr3L 9392316..9392416 1194..1094 505 100 Minus
chr3L 24539361 chr3L 9391994..9392082 1282..1194 445 100 Minus
chrX 22417052 chrX 1052926..1053303 1301..924 375 73.3 Minus
chr3R 27901430 chr3R 24849489..24849817 1292..964 340 73.6 Minus
chr3L 24539361 chr3L 6657539..6657707 1093..925 290 78.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RI 780 CG4035-PI 1..780 667..1446 3855 99.6 Plus
eIF-4E-RH 780 CG4035-PH 1..780 667..1446 3855 99.6 Plus
eIF-4E-RD 780 CG4035-PD 1..780 667..1446 3855 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RD 1723 CG4035-RD 26..1723 1..1698 8385 99.6 Plus
eIF-4E-RI 1793 CG4035-RI 251..1793 156..1698 7610 99.5 Plus
eIF-4E-RB 1484 CG4035-RB 180..1484 394..1698 6420 99.5 Plus
eIF-4E-RI 1793 CG4035-RI 26..182 1..157 785 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-PI 259 CG4035-PI 1..259 667..1443 1097 100 Plus
eIF-4E-PH 259 CG4035-PH 1..259 667..1443 1097 100 Plus
eIF-4E-PD 259 CG4035-PD 1..259 667..1443 1097 100 Plus
eIF-4E-PB 259 CG4035-PB 1..259 667..1443 1097 100 Plus
eIF-4E-PF 259 CG4035-PF 1..259 667..1443 1097 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9401040..9401608 723..155 2845 100 Minus
3L 28110227 3L 9399617..9400033 1699..1283 2010 98.8 Minus
3L 28110227 3L 9400583..9400953 1094..724 1855 100 Minus
3L 28110227 3L 9402279..9402435 157..1 785 100 Minus
3L 28110227 3L 9400419..9400519 1194..1094 490 99 Minus
3L 28110227 3L 9400097..9400185 1282..1194 430 98.9 Minus
X 23542271 X 1158961..1159338 1301..924 375 73.3 Minus
3R 32079331 3R 29026520..29026848 1292..964 355 73.9 Minus
3L 28110227 3L 6665168..6665336 1093..925 290 78.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9394140..9394708 723..155 2845 100 Minus
3L 28103327 3L 9392717..9393133 1699..1283 2010 98.8 Minus
3L 28103327 3L 9393683..9394053 1094..724 1855 100 Minus
3L 28103327 3L 9395379..9395535 157..1 785 100 Minus
3L 28103327 3L 9393519..9393619 1194..1094 490 99 Minus
3L 28103327 3L 9393197..9393285 1282..1194 430 98.8 Minus
X 23527363 X 1167242..1167369 1118..991 325 83.5 Minus
3L 28103327 3L 6658268..6658436 1093..925 290 78.1 Minus
3R 31820162 3R 28767533..28767679 1110..964 255 78.2 Minus
3L 28103327 3L 6657952..6658025 1277..1204 160 81 Minus
Blast to na_te.dros performed on 2014-11-27 08:13:24 has no hits.

FI05365.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:21:24 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9394188..9394343 1..156 100   Minus
chr3L 9392937..9393503 157..723 100 <- Minus
chr3L 9392480..9392850 724..1094 100 <- Minus
chr3L 9392316..9392415 1095..1194 100 <- Minus
chr3L 9391994..9392081 1195..1282 100 <- Minus
chr3L 9391515..9391930 1283..1698 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:39 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RE 1..780 667..1446 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:12 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RE 1..780 667..1446 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:03:36 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 1..780 667..1446 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:27 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RA 1..780 667..1446 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:24 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 1..780 667..1446 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:19 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 31..1728 1..1698 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:12 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 31..1728 1..1698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:03:36 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 26..1723 1..1698 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:28:47 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 31..1728 1..1698 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:24 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 26..1723 1..1698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:21:24 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9402280..9402435 1..156 100   Minus
3L 9401040..9401606 157..723 100 <- Minus
3L 9400583..9400953 724..1094 100 <- Minus
3L 9400419..9400518 1095..1194 99 <- Minus
3L 9400097..9400184 1195..1282 98 <- Minus
3L 9399618..9400033 1283..1698 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:03:36 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9395380..9395535 1..156 100   Minus
arm_3L 9394140..9394706 157..723 100 <- Minus
arm_3L 9393683..9394053 724..1094 100 <- Minus
arm_3L 9393519..9393618 1095..1194 99 <- Minus
arm_3L 9393197..9393284 1195..1282 98 <- Minus
arm_3L 9392718..9393133 1283..1698 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:25 Download gff for FI05365.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9395380..9395535 1..156 100   Minus
3L 9394140..9394706 157..723 100 <- Minus
3L 9393683..9394053 724..1094 100 <- Minus
3L 9393519..9393618 1095..1194 99 <- Minus
3L 9393197..9393284 1195..1282 98 <- Minus
3L 9392718..9393133 1283..1698 98 <- Minus

FI05365.pep Sequence

Translation from 666 to 1445

> FI05365.pep
MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKED
PQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSW
EDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAA
NKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRG
KSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQG
SNVKSIYTL*

FI05365.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23736-PA 261 GF23736-PA 1..261 1..259 1124 81 Plus
Dana\GF22031-PA 458 GF22031-PA 247..458 31..259 788 65.5 Plus
Dana\GF10894-PA 230 GF10894-PA 51..230 79..259 745 75.1 Plus
Dana\GF10327-PA 271 GF10327-PA 83..271 70..259 656 62.1 Plus
Dana\GF25106-PA 244 GF25106-PA 66..244 80..259 590 56.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14044-PA 250 GG14044-PA 8..250 19..259 1183 92.6 Plus
Dere\GG12718-PA 448 GG12718-PA 254..448 64..259 743 67.9 Plus
Dere\GG15032-PA 229 GG15032-PA 51..229 80..259 742 75.6 Plus
Dere\GG14453-PA 231 GG14453-PA 52..231 79..259 649 65.2 Plus
Dere\GG14292-PA 244 GG14292-PA 66..244 80..259 580 55 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16860-PA 275 GH16860-PA 1..275 1..259 1047 74.2 Plus
Dgri\GH15637-PA 233 GH15637-PA 17..233 31..259 710 61.1 Plus
Dgri\GH24331-PA 222 GH24331-PA 41..222 78..259 676 64.8 Plus
Dgri\GH14978-PA 232 GH14978-PA 3..232 34..259 651 52.8 Plus
Dgri\GH12729-PA 300 GH12729-PA 1..300 8..259 619 44.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-PI 259 CG4035-PI 1..259 1..259 1387 100 Plus
eIF-4E-PH 259 CG4035-PH 1..259 1..259 1387 100 Plus
eIF-4E-PD 259 CG4035-PD 1..259 1..259 1387 100 Plus
eIF-4E-PB 259 CG4035-PB 1..259 1..259 1387 100 Plus
eIF-4E-PF 259 CG4035-PF 1..259 1..259 1387 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14982-PA 311 GI14982-PA 4..310 3..258 748 51.8 Plus
Dmoj\GI12684-PA 246 GI12684-PA 67..246 79..259 721 72.9 Plus
Dmoj\GI13141-PA 238 GI13141-PA 59..238 79..259 639 62.4 Plus
Dmoj\GI13083-PA 125 GI13083-PA 43..125 177..259 414 91.6 Plus
Dmoj\GI16776-PA 198 GI16776-PA 97..162 78..143 230 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12850-PA 198 GL12850-PA 8..198 67..259 971 94.3 Plus
Dper\GL13241-PA 223 GL13241-PA 45..223 80..259 701 69.4 Plus
Dper\GL26506-PA 219 GL26506-PA 16..219 59..259 549 50.2 Plus
Dper\GL14400-PA 233 GL14400-PA 22..233 44..259 546 48.1 Plus
Dper\GL18042-PA 204 GL18042-PA 16..204 43..259 400 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28658-PA 263 GA28658-PA 1..263 1..259 1104 81.8 Plus
Dpse\GA28599-PA 223 GA28599-PA 45..223 80..259 705 70 Plus
Dpse\GA28380-PA 227 GA28380-PA 23..227 46..259 652 59.8 Plus
Dpse\GA24628-PA 234 GA24628-PA 56..234 80..259 595 57.2 Plus
Dpse\GA23005-PA 233 GA23005-PA 22..233 44..259 555 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24878-PA 269 GM24878-PA 9..269 1..259 1324 96.9 Plus
Dsec\GM13832-PA 229 GM13832-PA 51..229 80..259 726 73.9 Plus
Dsec\GM18997-PA 422 GM18997-PA 243..422 80..259 668 64.4 Plus
Dsec\GM25004-PA 233 GM25004-PA 2..233 36..259 642 52.3 Plus
Dsec\GM25034-PA 244 GM25034-PA 66..244 80..259 597 57.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12928-PA 269 GD12928-PA 9..269 1..259 1322 96.9 Plus
Dsim\GD13118-PA 229 GD13118-PA 51..229 80..259 726 73.9 Plus
Dsim\GD14038-PA 233 GD14038-PA 2..233 36..259 641 51.5 Plus
Dsim\GD14067-PA 244 GD14067-PA 66..244 80..259 597 57.2 Plus
Dsim\GD16435-PA 420 GD16435-PA 248..389 80..221 574 67.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13832-PA 272 GJ13832-PA 1..272 1..259 1061 77.6 Plus
Dvir\GJ19475-PA 323 GJ19475-PA 94..323 33..259 899 75.7 Plus
Dvir\GJ12668-PA 230 GJ12668-PA 51..230 79..259 721 72.9 Plus
Dvir\GJ16331-PA 301 GJ16331-PA 1..300 8..258 721 51.5 Plus
Dvir\GJ13889-PA 238 GJ13889-PA 59..238 79..259 644 62.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20927-PA 266 GK20927-PA 1..266 1..259 1102 79.9 Plus
Dwil\GK25580-PA 300 GK25580-PA 114..300 73..259 872 82.9 Plus
Dwil\GK12168-PA 260 GK12168-PA 1..260 8..259 871 64.3 Plus
Dwil\GK14373-PA 235 GK14373-PA 57..235 80..259 821 81.7 Plus
Dwil\GK16243-PA 360 GK16243-PA 166..360 62..259 774 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21247-PA 269 GE21247-PA 9..269 1..259 1286 94.6 Plus
Dyak\GE16544-PA 448 GE16544-PA 248..448 58..259 746 65.8 Plus
Dyak\GE20475-PA 229 GE20475-PA 51..229 80..259 734 75 Plus
Dyak\GE21642-PA 231 GE21642-PA 2..231 36..259 664 54.5 Plus
Dyak\GE20721-PA 244 GE20721-PA 66..244 80..259 583 55.6 Plus

FI05365.hyp Sequence

Translation from 666 to 1445

> FI05365.hyp
MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKED
PQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSW
EDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAA
NKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRG
KSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQG
SNVKSIYTL*

FI05365.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-PI 259 CG4035-PI 1..259 1..259 1387 100 Plus
eIF-4E-PH 259 CG4035-PH 1..259 1..259 1387 100 Plus
eIF-4E-PD 259 CG4035-PD 1..259 1..259 1387 100 Plus
eIF-4E-PB 259 CG4035-PB 1..259 1..259 1387 100 Plus
eIF-4E-PF 259 CG4035-PF 1..259 1..259 1387 100 Plus