Clone FI05371 Report

Search the DGRC for FI05371

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:53
Well:71
Vector:pOT2
Associated Gene/TranscriptEndoA-RA
Protein status:FI05371.pep: gold
Sequenced Size:3752

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
endoA 2008-08-15 Release 5.9 accounting
endoA 2008-12-18 5.12 accounting

Clone Sequence Records

FI05371.complete Sequence

3752 bp assembled on 2008-07-17

GenBank Submission: BT044220.1

> FI05371.complete
CCGCAGCTCCAGTGGCTTAGTGCCGTTGAAAATTGTTGTACACAGTCAAG
ATATTGATTTTTGCGAGCCGAGAGGAAAACGCGACCCCACAGCCCCCGCC
CCCTGTGCGCGACCAGTAGTAGTAGTAACGACTCACGGTCCTTCAAACAT
TACGCAGCCCAAGGTTCTGGAAAAAATCGAAGATTACGAGCAGAGCAACA
AAAAAAAAAACGGGGCAGAACGTGCAGAGCAAGCGAAGCGAGTGAAAGTG
CCCGCAGTAGTGGTCAGCAAAAGTAGAACTCGAACTCGGGCTACAGTTCA
CCAAGCCAATTCGAGTTTCCCGACTCGCAGCCTCCACTGAGCGAGCAGAA
GAGCCCCGGAAAGTAGCACCCCCAGCGGAGAAGGAACGGAGAAAAGTGCA
GTACGCGTAAGTCTTCCAAACGTAAACGTTTTAAAAATAGACACACTCAG
CCAGCCAGCCAGCCAGCCAGGCAGTCGGGCAGTCAGTGAGGCAGCCATCC
AGTCCATTGATGAAATTGTTGACTTGATGATATTGACATTGAATTTGAAA
TCGAGTCTCGACTAACCCAACCAACCCGTTCACAGCAACTGCGTCGAGCG
CCCCAAGACCAATTTAATCAGAGGAAGAAAACCAGAAGAGACAGCAGCAG
CCATGGCTTTCGCCGGACTCAAAAAGCAGATCAACAAGGCCAACCAGTAT
ATGACGGAGAAGATGGGCGGTGCCGAGGGCACCAAACTGGACATGGACTT
CATGGAGATGGAACGCAAGACGGACGTCACCGTGGAGCTAGTGGAGGAGC
TGCAGCTAAAGACGAAGGAGTTCCTGCAGCCGAATCCAACGGCACGGGCC
AAAATGGCAGCGGTCAAGGGCATCTCGAAGCTGTCCGGACAGGCCAAGTC
CAATACGTATCCGCAACCGGAGGGCCTGCTCGCGGAATGCATGCTGACTT
ATGGGAAGAAGCTCGGCGAGGACAACAGCGTGTTCGCGCAGGCGCTCGTC
GAATTCGGCGAAGCGCTGAAACAGATGGCCGACGTCAAGTATTCGCTGGA
CGACAACATCAAGCAGAACTTTTTGGAGCCACTGCATCATATGCAGACCA
AAGACCTCAAGGAGGTAATGCATCATCGCAAGAAGCTGCAGGGCCGGCGG
CTAGACTTTGACTGCAAGCGTCGCCGACAGGCCAAGGACGATGAGATTCG
TGGTGCCGAGGACAAGTTCGGTGAATCGCTCCAGCTGGCCCAGGTGGGCA
TGTTCAATTTGCTCGAGAACGATACGGAGCATGTCTCCCAGCTGGTCACC
TTTGCCGAGGCACTATACGATTTTCATTCGCAATGCGCGGATGTCCTTCG
AGGCCTGCAGGAGACACTGCAGGAGAAGCGCTCCGAGGCGGAGAGCCGGC
CACGCAACGAGTTCGTGCCCAAGACGCTGCTCGATCTGAACTTGGACGGC
GGTGGCGGCGGCCTCAACGAAGATGGCACGCCGTCTCACATTAGTTCGAG
CGCCTCGCCGTTGCCCTCGCCGATGCGTTCGCCCGCCAAGTCGATGGCCG
TAACGCCGCAGCGCCAGCAGCAGCCCTGCTGCCAGGCCCTCTACGACTTC
GAGCCGGAGAATCCCGGCGAACTGGCCTTCAAGGAGAACGACATTATCAC
CCTGTTGAATCGCGTCGACGACAATTGGTTCGAGGGCGCGGTGAATGGCC
GCACCGGTTACTTCCCGCAGTCGTATGTTCAGGTGCAGGTGCCCCTGCCC
AATGGCAACTAGGCTATTCCTCATCCTGTTCCTCGTATTAATCCCGATCC
CTAAACCAATCCCATCCTATCAAACTGGCTGAAGACGTACGTAGATCGCT
GATTGGAGAACAATAACCTTAATTGTTGGTTTCGCCACCAGAGGCGCGAA
ATTGGGCAGCCCAAGCCGATGCAGAAGCAGGAGCAGCAGAAGCAGCAGCA
GCAGCACATAAATGCAAATATATATATATAGTTGAATTAGATGAGCGGGT
TACTACGATTACGGATATTACGATACGGCTTAGCTAGCAGCACACAGCAG
GCTAAATTCATGGTGGCCATAGAGCAAGCTAACTAAATTTTATGTGCAAA
ATTATACCAGTTGGCAACACAATAATTAACAAATTAACTACGAGTTAAAT
TAATGTACGTATTAACTAACTAAATTTACAAGACGTTACGCGCGCAATGC
CACTTCCTTGCGTTTTTACCTTTGATTCTCAAACGTCAGCTTTGTTGTTC
GTTGCAAGTTGCGAACATTTAGTACTACTTCACACAATAGATCGATCACG
TATTAGAACAGTTGGTCCGGCGGCAGAAGCAAACAGAAAAACACTCTAGC
TAATTAACTAAATTACCCGTGTAATCTTAATCACGCCCATGGAGGCGCGT
CTCTTTTGTCTTTCCACCTGAGTTCTTCTAGCCTCCAGTTTTCGGAGGTC
TTTTTATCCGGTCTCATCGTTGTAATTTAAACCAACCTACGCCAATGCGC
TCTCTATGCAAATGTCCCTTTATAGGCTAAAGCTACGTATCCACACCATA
CGCCCGCCCACATGCATATACATATTTATTATATACCCGAAAATACCTAC
ATATACCTACTCTACCTACGTATATTTGTGCAAAAACAATACTCCCCACA
CTCTATTCTAAAAGGCATACGGAATACCGTTCTTGATGTTCGTTGTTCAA
TGTAAAGAATAATTCAATTCAATTTTTCGAGGATGAAACAAGCGAAATTT
GTATCCTACTTTTTGCTCCTTTTTATGTGTGTTGTTTTTTTTGTTTGTTA
ATTATATACATAACAACTATATATATATATATTAAATGAAATCAAATATA
TGTATAAATATATTTATTAAGCGTATTATCTACATGTATATTTATTATTA
TGTATTTATTATAAATTATACTGAGCAGCAACGTAAACAATATAATGAAT
ATTTAAACGATGATAACAGATAAAAAGTACTAGCGGCAAGTAAATGTAAC
AGAATCCTCCTAAACAATACCAACCAACAAGCATAATACTAGTTAAACGA
TTTCCACAAAAATGTTGATAATAATAACTTTAAACGTAAGCAAAATCCAG
TCAAGTCAATCGAAGCATAGCAACACTTACGAACCTACTAACGCGTTTAC
CAACCGCAACTCTAGATCAAATATTTATATATTTAACGAGATAATAATAA
ACATTCGACGGCAAACCGATAAAATGATTCAAAATAGTCTCATGCTGGCA
TACAGCTATGCACGATATACATACGAATGTATATACATATATATACTCGT
ACGTTTAGGAATGATATACACAAGATACATATATATTTACGTATGAAGAA
AACCATTGAATTGAAAGCCATGCAACTTGTGTTGATAATAAATTTGTTAA
ATGCCAAGAAAACATTTAACAGAATTATATATTCGAGTGCGAAGATGAAA
CATTTGCCTCGTGGACGGACAGACTGCCAGTGCGAACATTTCCAGAGGAT
ACCCCATCTGGGGAGGATCCACCCATCGCCTGGAGACTATCTTTCCACGC
GATACACACTTGCCCCACGTGCAGCGGGGCCCGAACTTCAAACAATAATT
ATTGTAATTTTGCATTTTTGTGTGGGCGGTAACTTGAATAATATATATTA
CAAGGCATATACATAATAATAATAACTATGCTAAAACTGAAGACCCTAAT
TTATGCAAACCAAAATTAATAAAATTTAATTTTTAAAAAAAAAAAAAAAA
AA

FI05371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
endoA-RB 3739 endoA-RB 6..3739 1..3734 18655 99.9 Plus
endoA-RA 3691 endoA-RA 497..3647 586..3736 15740 99.9 Plus
endoA.a 3636 endoA.a 1748..3592 1892..3736 9210 99.9 Plus
endoA.a 3636 endoA.a 497..1747 586..1836 6255 100 Plus
endoA-RA 3691 endoA-RA 91..496 1..406 2030 100 Plus
endoA.a 3636 endoA.a 91..496 1..406 2030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14730605..14734338 1..3734 18490 99.7 Plus
chr3RHet 2517486 chr3RHet 161718..162229 2790..2281 2225 96.5 Minus
chr3RHet 2517486 chr3RHet 161648..161720 2935..2863 350 98.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
EndoA-RC 1110 CG14296-PC 1..1110 653..1762 5550 100 Plus
EndoA-RB 1110 CG14296-PB 1..1110 653..1762 5550 100 Plus
EndoA-RA 1110 CG14296-PA 1..1110 653..1762 5550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
EndoA-RB 3740 CG14296-RB 7..3740 1..3734 18655 100 Plus
EndoA-RA 3561 CG14296-RA 413..3561 586..3734 15730 100 Plus
EndoA-RC 3913 CG14296-RC 1664..3506 1892..3734 9200 99.9 Plus
EndoA-RA 3561 CG14296-RA 7..412 1..406 2030 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
EndoA-PC 369 CG14296-PC 1..369 653..1759 1720 100 Plus
EndoA-PB 369 CG14296-PB 1..369 653..1759 1720 100 Plus
EndoA-PA 369 CG14296-PA 1..369 653..1759 1720 100 Plus
EndoB-PD 366 CG9834-PD 21..254 680..1369 205 25.4 Plus
EndoB-PB 378 CG9834-PB 21..254 680..1369 205 25.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18906615..18910350 1..3736 18665 100 Plus
3R 32079331 3R 1272155..1272666 2281..2790 2225 96.5 Plus
3R 32079331 3R 1272664..1272736 2863..2935 350 98.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18647446..18651181 1..3736 18665 99.9 Plus
3R 31820162 3R 1069733..1070123 2281..2672 1845 98.4 Plus
3R 31820162 3R 1070131..1070244 2677..2790 495 95.6 Plus
3R 31820162 3R 1070242..1070314 2863..2935 350 98.6 Plus
Blast to na_te.dros performed 2014-11-27 09:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 291..374 2100..2181 126 65.9 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 8160..8194 1934..1968 121 82.9 Plus
TART-C 11124 TART-C TARTC 11124bp 9604..9638 1934..1968 121 82.9 Plus

FI05371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:21:47 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14730605..14734338 1..3734 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:40 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 1..1110 653..1762 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:31 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 1..1110 653..1762 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:29:48 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RA 1..1110 653..1762 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:59 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 1..1110 653..1762 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:47 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
EndoA-RA 1..1110 653..1762 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:02 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 6..3739 1..3734 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:30 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 6..3739 1..3734 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:29:48 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 7..3740 1..3734 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:59 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
endoA-RB 6..3739 1..3734 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:47 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
EndoA-RB 7..3740 1..3734 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:21:47 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18906615..18910348 1..3734 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:29:48 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14732337..14736070 1..3734 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:31 Download gff for FI05371.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18647446..18651179 1..3734 99   Plus

FI05371.pep Sequence

Translation from 652 to 1761

> FI05371.pep
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEEL
QLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTY
GKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTK
DLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGM
FNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRP
RNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAV
TPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGR
TGYFPQSYVQVQVPLPNGN*

FI05371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23220-PA 369 GF23220-PA 1..369 1..367 1720 98.4 Plus
Dana\GF11655-PA 457 GF11655-PA 21..266 10..239 189 25 Plus
Dana\GF11645-PA 843 GF11645-PA 133..197 302..366 165 47.7 Plus
Dana\GF11180-PA 211 GF11180-PA 153..206 306..359 154 46.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\endoA-PA 369 GG23082-PA 1..369 1..369 1981 100 Plus
Dere\GG20916-PA 450 GG20916-PA 21..441 10..361 185 22.2 Plus
Dere\GG21801-PA 837 GG21801-PA 127..196 302..366 157 44.3 Plus
Dere\GG22486-PA 211 GG22486-PA 153..206 306..359 154 46.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18864-PA 369 GH18864-PA 1..369 1..369 1770 96.7 Plus
Dgri\GH23075-PA 392 GH23075-PA 21..381 10..361 201 23.1 Plus
Dgri\GH22624-PA 211 GH22624-PA 153..206 306..359 155 46.3 Plus
Dgri\GH20925-PA 871 GH20925-PA 131..207 290..366 155 41.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
EndoA-PC 369 CG14296-PC 1..369 1..369 1919 100 Plus
EndoA-PB 369 CG14296-PB 1..369 1..369 1919 100 Plus
EndoA-PA 369 CG14296-PA 1..369 1..369 1919 100 Plus
EndoB-PB 378 CG9834-PB 21..369 10..361 234 23.6 Plus
EndoB-PA 390 CG9834-PA 21..381 10..361 222 23.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22969-PA 367 GI22969-PA 1..367 1..367 1759 96.7 Plus
Dmoj\GI21143-PA 467 GI21143-PA 21..266 10..239 187 25 Plus
Dmoj\GI21333-PA 211 GI21333-PA 156..206 309..359 153 49 Plus
Dmoj\GI18363-PA 853 GI18363-PA 139..203 302..366 150 46.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23440-PA 369 GL23440-PA 1..369 1..369 1778 97.3 Plus
Dper\GL11787-PA 392 GL11787-PA 21..383 10..361 210 23.9 Plus
Dper\GL18423-PA 783 GL18423-PA 556..725 220..360 161 29.4 Plus
Dper\GL11468-PA 858 GL11468-PA 146..204 308..366 160 49.2 Plus
Dper\GL17069-PA 211 GL17069-PA 153..206 306..359 155 46.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\endoA-PA 369 GA12885-PA 1..369 1..369 1778 97.3 Plus
Dpse\GA22064-PB 380 GA22064-PB 21..371 10..361 214 23.9 Plus
Dpse\GA22064-PA 392 GA22064-PA 21..383 10..361 202 23.7 Plus
Dpse\GA22064-PC 364 GA22064-PC 21..254 10..239 196 25.8 Plus
Dpse\GA29289-PA 783 GA29289-PA 556..725 220..360 161 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17895-PA 369 GM17895-PA 1..369 1..369 1981 100 Plus
Dsec\GM19839-PA 438 GM19839-PA 21..429 10..361 186 22.5 Plus
Dsec\GM21803-PA 838 GM21803-PA 127..196 302..366 159 44.3 Plus
Dsec\GM20273-PA 211 GM20273-PA 153..206 306..359 154 46.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19255-PA 369 GD19255-PA 1..369 1..369 1981 100 Plus
Dsim\GD11292-PA 839 GD11292-PA 127..196 302..366 159 44.3 Plus
Dsim\drk-PA 182 GD25755-PA 124..177 306..359 153 46.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\endoA-PA 369 GJ14546-PA 1..369 1..369 1775 97 Plus
Dvir\GJ20990-PA 388 GJ20990-PA 21..379 10..361 173 21.3 Plus
Dvir\GJ19679-PA 211 GJ19679-PA 153..206 306..359 155 46.3 Plus
Dvir\GJ21432-PA 857 GJ21432-PA 137..204 304..366 152 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\endoA-PA 366 GK22746-PA 1..366 1..366 1949 98.9 Plus
Dwil\GK19643-PA 386 GK19643-PA 21..378 10..361 209 22.6 Plus
Dwil\GK10660-PA 211 GK10660-PA 153..206 306..359 155 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25564-PA 369 GE25564-PA 1..369 1..369 1981 100 Plus
Dyak\GE13854-PA 390 GE13854-PA 21..381 10..361 215 23.3 Plus
Dyak\GE11877-PA 837 GE11877-PA 127..196 302..366 159 44.3 Plus
Dyak\GE13357-PA 211 GE13357-PA 153..206 306..359 155 46.3 Plus

FI05371.hyp Sequence

Translation from 652 to 1761

> FI05371.hyp
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEEL
QLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTY
GKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTK
DLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGM
FNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRP
RNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAV
TPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGR
TGYFPQSYVQVQVPLPNGN*

FI05371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
EndoA-PC 369 CG14296-PC 1..369 1..369 1919 100 Plus
EndoA-PB 369 CG14296-PB 1..369 1..369 1919 100 Plus
EndoA-PA 369 CG14296-PA 1..369 1..369 1919 100 Plus
EndoB-PB 378 CG9834-PB 21..369 10..361 234 23.6 Plus
EndoB-PA 390 CG9834-PA 21..381 10..361 222 23.4 Plus