Clone FI05373 Report

Search the DGRC for FI05373

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:53
Well:73
Vector:pOT2
Associated Gene/TranscriptCG43427-RJ
Protein status:FI05373.pep: gold
Sequenced Size:3911

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31534 2008-08-15 Release 5.9 accounting
CG31534 2008-12-18 5.12 accounting

Clone Sequence Records

FI05373.complete Sequence

3911 bp assembled on 2008-07-17

GenBank Submission: BT044221.1

> FI05373.complete
ATATTGGTTCTGGCGGGACAGTTCCGTATATTCTTGGTCCCACACATGTG
TCTGTGGCGCGTTATCTTTACGGCACACCGTAATAATAAAATCGCGAATT
ATTCGCATTGGACAGTATCTAAACTACGTCCCACAAATACCAACTAAACC
GATTGCAGCGCTGCAGTTCGTTGAATCGTGTCGATCATACACCAGGGATC
AACGAAGCTCTTGAATTGGCGCTGCAAGCTATTGATCGCGAGGCGACAAC
CAAGCCAATGGACAAGGCACAACATCCACAGAAGCGGGAACAGAAGGAGG
AGCTGGGAGGTAAGCCGGAGGAGAAGGAGCCAATTTGCGAGGAGCAGCAC
GACGAAGAGTCCAACGAGCAGGGGGAAACACACAACGAGGGTGGGGAAAT
GCCAAATAAAACCGATAAGCAAATGCAGGGGGGACGAGAGCCCATCTATG
AGAATGTCAGCTCGACTATATCTATGCATGAAGTAGATAATGAACAGATA
GCAACTATGACGATAACCACACAGACCCAAGCGACGCGAATAAGTCACAG
GAGAAGCATTCCAAGCCAGCAAACCAGCAACAGTAACGAGAATAATCAAA
GCACTAATCAAACCAGCAACAGCAGGAATCAAAAAGAGAGCAGCACAGCA
GCAACATCGGCAGCGAACCCCGTGCCACCAACAACACCGGGGGAACAAGC
AGAGCCCTACTACCAAGTGCCGAAGGCCACGGAGCCCTACTACGATGCCC
CCAAGCATTTAAGGCCGGTGCCGGTATACGAAAATGTCGAGATCTTTTAC
TCGGGCCTGGAGATTAGTCAGGGATCTGTGGGAGCGCCAGTAGGGCTGAT
GGAGCCACCCAAGGAAAAGCCACCACCACCGCCCACCGAGAGTCCGATTC
CGCTGGACGAGGGCCATGACGACGAGCTGGATGGACTGGGCAACAGTCTG
GGCCACAACACAGACACCTGGTCATCGGACAACACCTACGAGACCATATC
GAACGGCACTCGCCGGCACCTTCAGGGACAACCGGAACCCGCCCAACCCT
CGCCGCCCATCAAGAGGATGAACTCGACCAAACGGATCAAGAAGGAGTTG
CGCAACAAGCGCTCCAGCTTCCTGGGCATCGAAAACGACGGCGATCTTGA
CGACATGGAGACCTATCTCGAGCTAACAGTGGCCCCGCCTCCGGATATGG
CGCAGCTCTTGCAGGAGGAGCGGCGACTGGAGAAGCAGCTGTACATCAAG
GCGGGACTCTGCGACAGTTCCGACACAGGTGAAAGCCGCGATTCTGGAGT
TTCTGAAAACCACTCTCGCCAGAGCAGTGAGCACTACACGAACTCCTCTG
AGGAGAACGATACACAGTCAGAGGCCACACCGCCGCCATTGCCTCCACCA
CCATCGACCGCCCAAGTGGGTGAAGTCATATACCAAAATGAGAGCCTCCT
GGCTGCCCAGACGCCGCTTCTCCAGACGGTAAAAGGAAACTCCGCCGAGT
CCTGGACCGAATCAGCAACGGCCGCAGCGGCGGCCACGCAATCATTGAGC
GAAGCCACAGCAACGGCCAATGCCAAGATGCAGTCCATCGAGGATAAGAT
CCGGGAGCAGGGAGAGATGTTGCGGGTGGAACGCGAGCTACTGCACTTCT
CGCAAGAGGAACTGAAACGGCAACGTGAAAATCTTGTGCTTCGAGAAAAT
ATTGCTCGACGAGAGTTGCAACACGGAGCCAAGATGCTGATGTCGAACAA
CCGGCGCTCACTGCAGGATCTGCACCACGGTCTAGGAATCGGAAACGGAA
TGCTCAGTGCCTTCCAGCCACCGCAACACCACCAGGTTCAAATGCCACCA
CCGCATCCGCAACAGATTTACGCCAATGTGCCGCAGCAGCAGCAACAGAT
GGTTCTGCATGCATATCACCAGATGGACACGGACTACCGCAAGTCCATGT
CGGATCTAAACGAGTTCTCCAACTGCCTGATACTGCCGCCAACGCCGCCC
ACAAAGCCATTGAGGGCTATGCAATTGAACGCCAATGGCCATGGCCTGGA
GCCAGATTACGCTGTTAGCACGAGGCAGCGCCAACCACCGGCTCCGTACG
GTGGCTCTCTGGTAAAGATTGCTGGAGCACCAATGCCGCCACGGCTCCCC
GGTCAAGGATATCCCATTCAAGCGCCGACAGCGCCAGCATACCATCACCA
GTCGGCCCAAAACTTAAGCAATATGTCCAGAAACACATTGCTCGCTTTGA
GTGCCACCCCCAAACCAAAATACGCGGACGGATGGGTGCAGGTGCAGCAG
CGGAAGAGTTATGACAGCCAACAGACCAGCGATGCGGCTTGGCTGGCCGC
TCAGCAGCAAAAGCGCAAATCCATGCCTGACTACGGCGGAGCACTCTACA
ATAACAACCACTGGCTACTGCAGGAGGCGGAGCAGCGACGCATCGAGCAA
CTTAATCGGCGATCTATACCAGCCAGCAAGTCGATGGGCAAACCGCTGCC
CGATTCCATCATACAAACTCTTACGGAGCGGGTCCAGAGCAAAGGAATCG
GCGATCGAAAGCGCTTCGATAGCAACGGGAACTATAGCCAGGTAAATGGC
AACAACATCTACCAGCAGCAACAGCAGCAGAAGAATGTGACGAATGGCAG
CAGCATCAATGGCAACAGCAGCCAGGGGCAGGAGAAGGTGCTCAGCGTTA
GTGGCAAGAAGAAGTGCTCCCATTGCGGCGACGAATTAGATCTGGGCTGC
ACTCACGGCAATTGTCGGCAGGTGCACAAAGCGCTAAAATATATTGTTTG
GGTGTAAATTTAAAAAGACTGCCCAACAGTTTCGAATATTTTAGGTCGCG
GCGCTGCCATGATCATCGAATCGCTTCTGCTGTTCTACCACATCAACTGC
TTCAAGTGTTGCGTCTGCCACGTCCAGCTGGGAGATGGCCTCAATGGAAC
CGATGTCCGGGTGCGAAACCACAAGCTGCATTGCCAAAACTGCTACTCCA
GCGATGACGGCATTAAGTTCAGCTGCGTCTAACTGAGCCCTCGCCATGGA
AACGGAAGTGGATTATTGAATAGAACTGGGGTTGTTGCTCTGTTGCTTTT
GCAACATTGATTGTTGTTGTTGTACTAGTAATACATAGATATTAAATAGA
GATGATAATTCGTACGTTCACATATATACAATACATATATCTACATATGT
TGAGAACAAAGTCAAATCCAAAACGTTTCAGATTAGTGTTAATCGCTTTA
ATATGCTTCCCTACGAAATTATGTAATGTTTTAACTCGGATTTAAAAGTT
TTATACAACGCATTCTACATGTTATAAATCAAACTCTATACATTTTACAT
GTTTAAATGCCAAGCTCTCTAACATTGTAACAAAGTAATGTGTGTTGAAA
CTTAAAAAAAAAACCAAAAAAAGGATTAACTTTAAACGAAGTGTTAAAAT
TTTGAAATTGTTTTGAATTTATATTTACACCTCTACTCTACACATCTACA
CAATCTACTATTTCTATCCGAAAATTCGCTTTTAAATTAGTTAGTTTCTA
ACTTTTTGTACCCGCTACAGCCCACTTAAAATACCTAACGACGCATCCAA
TGTACCTAAAAAAAACTATATACAAACACCCATCCACACGCAACTCACTA
ACATAATTATTATATACATACCCTTAAACTTGCATGAGGTGAGCATATAT
CGCGAAAGATTTCATTTCTTATATCCCTTATTTTTATTTATTGTAATTTC
GCATAAAGTTGAAAATTTGTATATTATATACACATCTTGGATTGTATGAT
TAATTTTTAAACATGATCGGTATATGAATAATTTTTCTGTATAAATACAT
CAAAGAAGATATAGTTTAGTTTTTTAATAAACTATTTCAATGAAAAAAAA
AAAAAAAAAAA

FI05373.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31534-RB 4163 CG31534-RB 24..3917 1..3894 19470 100 Plus
CG31534-RC 4230 CG31534-RC 24..2762 1..2739 13695 100 Plus
CG31534-RA 4058 CG31534-RA 24..2762 1..2739 13695 100 Plus
CG31534-RA 4058 CG31534-RA 2759..3812 2841..3894 5270 100 Plus
CG31534-RC 4230 CG31534-RC 2934..3984 2844..3894 5255 100 Plus
CG31534-RC 4230 CG31534-RC 2787..2893 2740..2846 535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 532734..533817 197..1280 5420 100 Plus
chr3R 27901430 chr3R 536605..537654 2843..3892 5250 100 Plus
chr3R 27901430 chr3R 534868..535779 1652..2563 4560 100 Plus
chr3R 27901430 chr3R 534383..534758 1277..1652 1880 100 Plus
chr3R 27901430 chr3R 531878..532074 1..197 985 100 Plus
chr3R 27901430 chr3R 535885..536061 2563..2739 885 100 Plus
chr3R 27901430 chr3R 536323..536431 2738..2846 545 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RH 4482 CG43427-PH 1873..4482 198..2807 13050 100 Plus
CG43427-RJ 2550 CG43427-PJ 1..2550 258..2807 12750 100 Plus
CG43427-RP 4506 CG43427-PP 1873..4414 198..2739 12710 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:14:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RJ 4163 CG43427-RJ 24..3915 1..3892 19460 100 Plus
CG43427-RH 6180 CG43427-RH 2486..6180 198..3892 18475 100 Plus
CG43427-RI 3810 CG43427-RI 24..2762 1..2739 13695 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PO 1541 CG43427-PO 625..1541 198..3029 3652 96.4 Plus
CG43427-PM 1533 CG43427-PM 625..1533 198..3029 3642 96.3 Plus
CG43427-PI 889 CG43427-PI 1..889 258..3029 3547 96.2 Plus
CG43427-PH 1493 CG43427-PH 625..1493 198..2804 3467 100 Plus
CG43427-PP 1501 CG43427-PP 625..1501 198..2804 3441 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4707025..4708108 197..1280 5420 100 Plus
3R 32079331 3R 4710896..4711947 2843..3894 5260 100 Plus
3R 32079331 3R 4709159..4710070 1652..2563 4560 100 Plus
3R 32079331 3R 4708674..4709049 1277..1652 1880 100 Plus
3R 32079331 3R 4706169..4706365 1..197 985 100 Plus
3R 32079331 3R 4710176..4710352 2563..2739 885 100 Plus
3R 32079331 3R 4710614..4710722 2738..2846 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4447856..4448939 197..1280 5420 100 Plus
3R 31820162 3R 4451727..4452778 2843..3894 5260 100 Plus
3R 31820162 3R 4449990..4450901 1652..2563 4560 100 Plus
3R 31820162 3R 4449505..4449880 1277..1652 1880 100 Plus
3R 31820162 3R 4447000..4447196 1..197 985 100 Plus
3R 31820162 3R 4451007..4451183 2563..2739 885 100 Plus
3R 31820162 3R 4451445..4451553 2738..2846 545 100 Plus
Blast to na_te.dros performed 2014-11-27 09:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6823 1815..1898 168 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1070..1154 599..685 158 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1064..1175 548..656 146 63.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6843 1815..1897 145 63.9 Plus
roo 9092 roo DM_ROO 9092bp 1067..1149 1815..1897 127 61.4 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 7205..7320 895..1008 125 57.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2422 1815..1897 118 60.2 Plus

FI05373.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:21:38 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 536607..537654 2845..3892 100   Plus
chr3R 536325..536429 2740..2844 100 -> Plus
chr3R 535886..536061 2564..2739 100 -> Plus
chr3R 534869..535779 1653..2563 100 -> Plus
chr3R 534385..534758 1279..1652 100 -> Plus
chr3R 532735..533815 198..1278 100 -> Plus
chr3R 531878..532074 1..197 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:42 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 1..2550 258..2807 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:40 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 1..2550 258..2807 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:29:42 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RH 1873..4482 198..2807 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:54:09 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 1..2550 258..2807 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:38 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RH 1873..4482 198..2807 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:16 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 24..3915 1..3892 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:40 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 24..3915 1..3892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:29:42 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RJ 24..3915 1..3892 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:54:09 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 24..3915 1..3892 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:38 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RJ 24..3915 1..3892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:21:38 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4710898..4711945 2845..3892 100   Plus
3R 4710616..4710720 2740..2844 100 -> Plus
3R 4710177..4710352 2564..2739 100 -> Plus
3R 4709160..4710070 1653..2563 100 -> Plus
3R 4708676..4709049 1279..1652 100 -> Plus
3R 4707026..4708106 198..1278 100 -> Plus
3R 4706169..4706365 1..197 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:29:42 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 536620..537667 2845..3892 100   Plus
arm_3R 536338..536442 2740..2844 100 -> Plus
arm_3R 535899..536074 2564..2739 100 -> Plus
arm_3R 534882..535792 1653..2563 100 -> Plus
arm_3R 534398..534771 1279..1652 100 -> Plus
arm_3R 532748..533828 198..1278 100 -> Plus
arm_3R 531891..532087 1..197 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:43 Download gff for FI05373.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4451729..4452776 2845..3892 100   Plus
3R 4451447..4451551 2740..2844 100 -> Plus
3R 4451008..4451183 2564..2739 100 -> Plus
3R 4449991..4450901 1653..2563 100 -> Plus
3R 4449507..4449880 1279..1652 100 -> Plus
3R 4447857..4448937 198..1278 100 -> Plus
3R 4447000..4447196 1..197 100 -> Plus

FI05373.pep Sequence

Translation from 257 to 2806

> FI05373.pep
MDKAQHPQKREQKEELGGKPEEKEPICEEQHDEESNEQGETHNEGGEMPN
KTDKQMQGGREPIYENVSSTISMHEVDNEQIATMTITTQTQATRISHRRS
IPSQQTSNSNENNQSTNQTSNSRNQKESSTAATSAANPVPPTTPGEQAEP
YYQVPKATEPYYDAPKHLRPVPVYENVEIFYSGLEISQGSVGAPVGLMEP
PKEKPPPPPTESPIPLDEGHDDELDGLGNSLGHNTDTWSSDNTYETISNG
TRRHLQGQPEPAQPSPPIKRMNSTKRIKKELRNKRSSFLGIENDGDLDDM
ETYLELTVAPPPDMAQLLQEERRLEKQLYIKAGLCDSSDTGESRDSGVSE
NHSRQSSEHYTNSSEENDTQSEATPPPLPPPPSTAQVGEVIYQNESLLAA
QTPLLQTVKGNSAESWTESATAAAAATQSLSEATATANAKMQSIEDKIRE
QGEMLRVERELLHFSQEELKRQRENLVLRENIARRELQHGAKMLMSNNRR
SLQDLHHGLGIGNGMLSAFQPPQHHQVQMPPPHPQQIYANVPQQQQQMVL
HAYHQMDTDYRKSMSDLNEFSNCLILPPTPPTKPLRAMQLNANGHGLEPD
YAVSTRQRQPPAPYGGSLVKIAGAPMPPRLPGQGYPIQAPTAPAYHHQSA
QNLSNMSRNTLLALSATPKPKYADGWVQVQQRKSYDSQQTSDAAWLAAQQ
QKRKSMPDYGGALYNNNHWLLQEAEQRRIEQLNRRSIPASKSMGKPLPDS
IIQTLTERVQSKGIGDRKRFDSNGNYSQVNGNNIYQQQQQQKNVTNGSSI
NGNSSQGQEKVLSVSGKKKCSHCGDELDLGCTHGNCRQVHKALKYIVWV*

FI05373.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19955-PA 821 GF19955-PA 8..821 60..849 3089 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12563-PA 906 GG12563-PA 56..906 1..849 3688 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19501-PA 885 GH19501-PA 22..885 32..849 2334 64.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PJ 849 CG43427-PJ 1..849 1..849 4475 100 Plus
CG43427-PH 1493 CG43427-PH 645..1493 1..849 4475 100 Plus
CG43427-PP 1501 CG43427-PP 645..1501 1..849 4449 98.9 Plus
CG43427-PO 1541 CG43427-PO 645..1481 1..837 4359 99.2 Plus
CG43427-PI 889 CG43427-PI 1..830 1..830 4349 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23772-PA 832 GI23772-PA 14..832 48..849 2365 63.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22332-PA 601 GL22332-PA 151..577 149..597 1662 78.4 Plus
Dper\GL22333-PA 208 GL22333-PA 1..149 656..830 450 57.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30203-PF 1585 GA30203-PF 735..1585 48..849 2938 77.6 Plus
Dpse\GA30203-PB 910 GA30203-PB 60..910 48..849 2907 77.8 Plus
Dpse\GA30203-PA 1625 GA30203-PA 735..1582 48..836 2802 75.8 Plus
Dpse\GA30203-PC 950 GA30203-PC 60..891 48..830 2775 77.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10773-PA 804 GM10773-PA 1..804 1..849 3690 91.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19746-PA 553 GD19746-PA 170..553 466..849 1945 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23955-PA 889 GJ23955-PA 51..889 48..849 2350 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12820-PA 926 GK12820-PA 39..926 43..849 2523 67.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25434-PA 850 GE25434-PA 1..850 1..849 3799 91.1 Plus

FI05373.hyp Sequence

Translation from 257 to 2806

> FI05373.hyp
MDKAQHPQKREQKEELGGKPEEKEPICEEQHDEESNEQGETHNEGGEMPN
KTDKQMQGGREPIYENVSSTISMHEVDNEQIATMTITTQTQATRISHRRS
IPSQQTSNSNENNQSTNQTSNSRNQKESSTAATSAANPVPPTTPGEQAEP
YYQVPKATEPYYDAPKHLRPVPVYENVEIFYSGLEISQGSVGAPVGLMEP
PKEKPPPPPTESPIPLDEGHDDELDGLGNSLGHNTDTWSSDNTYETISNG
TRRHLQGQPEPAQPSPPIKRMNSTKRIKKELRNKRSSFLGIENDGDLDDM
ETYLELTVAPPPDMAQLLQEERRLEKQLYIKAGLCDSSDTGESRDSGVSE
NHSRQSSEHYTNSSEENDTQSEATPPPLPPPPSTAQVGEVIYQNESLLAA
QTPLLQTVKGNSAESWTESATAAAAATQSLSEATATANAKMQSIEDKIRE
QGEMLRVERELLHFSQEELKRQRENLVLRENIARRELQHGAKMLMSNNRR
SLQDLHHGLGIGNGMLSAFQPPQHHQVQMPPPHPQQIYANVPQQQQQMVL
HAYHQMDTDYRKSMSDLNEFSNCLILPPTPPTKPLRAMQLNANGHGLEPD
YAVSTRQRQPPAPYGGSLVKIAGAPMPPRLPGQGYPIQAPTAPAYHHQSA
QNLSNMSRNTLLALSATPKPKYADGWVQVQQRKSYDSQQTSDAAWLAAQQ
QKRKSMPDYGGALYNNNHWLLQEAEQRRIEQLNRRSIPASKSMGKPLPDS
IIQTLTERVQSKGIGDRKRFDSNGNYSQVNGNNIYQQQQQQKNVTNGSSI
NGNSSQGQEKVLSVSGKKKCSHCGDELDLGCTHGNCRQVHKALKYIVWV*

FI05373.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PJ 849 CG43427-PJ 1..849 1..849 4475 100 Plus
CG43427-PH 1493 CG43427-PH 645..1493 1..849 4475 100 Plus
CG43427-PP 1501 CG43427-PP 645..1501 1..849 4449 98.9 Plus
CG43427-PO 1541 CG43427-PO 645..1481 1..837 4359 99.2 Plus
CG43427-PI 889 CG43427-PI 1..830 1..830 4349 99.8 Plus