Clone FI05443 Report

Search the DGRC for FI05443

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:54
Well:43
Vector:pOT2
Associated Gene/Transcriptbgm-RA
Protein status:FI05443.pep: gold
Sequenced Size:2507

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
bgm 2008-12-18 5.12 accounting

Clone Sequence Records

FI05443.complete Sequence

2507 bp assembled on 2008-08-28

GenBank Submission: BT044224.1

> FI05443.complete
CGCTGAATTCGGTCGTGTTTGCTGTCGTGGTTCTCGAGCGAAAGAAAGAG
TGGGAGTATAGAAAATAGACGGCAATCGATTTGCGTGACCAAAGAACAAA
TATATACATACATATATCGAGAACGCCGTAGAAACACCAAACTAGTTAAT
TATCCTTGCAACATGTCCACGATAGACGCGCTCTACAATCGTCCTGGGCC
CAACCGCCTGCGGCAGGCGGATGCCTATCGCACCACCAATCGTCAGGATG
CCGTCAAGATTCGTATGGCCAAGGATGGAATCGGCGCAGAGGAGCCCATC
TCCGTGCCCGGCCTGCTGAAGCGTACGGTCAACAATTACGGCGACTATCC
TGCGCTGCGCACCAAGAACGGCAAAAACGGATATCACACTGTCACCTACA
AACAATATGAGCAGAAGGTGCACCAGGTGGCCAAGGCGTTCATTAAGCTC
GGTCTGGAGGAGCACCATTCGGTGGGTGTGCTGGCCTTCAATTGCGCCGA
ATGGTTCTACTCGGCCATGGGCGCCATTCACGCACGAGGCATCATCGCCG
GAATCTACACCACCAATTCCGCCGATGCAGTGCAGCACGTTCTGGAGAGC
TCACATGCCCAAATCGTGGTCGTCGACGACGCCAAGCAAATGGACAAGAT
TCACGCCATTCGCGACAAGCTGCCCAAGCTCAAGGCCGCCATTCAGATCC
AGGAGCCCTATTCCCCCTACTTGAAGAAGGAGGATGGCTACTACAGGTGG
TCGGAGATCGAGTCGATGAACGTTAGCGACGTGGAGGATCAGTACATGAC
CCGTTTGGAGAATGTGGCGATCAACGAGTGCTGCTGCCTGGTCTACACCT
CCGGAACGGTGGGCATGCCCAAGGGCGTGATGCTCTCCCACGACAACATC
ACCTTCGATGTGCGCGGCATCGTCAAGGCCATGGACCGTGTGGTGGTTGG
GGCGGAGTCGATCGTCTCCTACCTGCCACTTTCGCACGTGGCCGCCCAGA
CCGTGGACATTTACACCTGCGCCTTTGTGGCGGGCTGCATTTGGTTCGCC
GACAAGGATGCGCTGAAGGGAACGCTGGTGAAGTCGCTGCAGGATGCGCG
ACCCACGCGATTCATGGGCGTGCCGCGTGTGTACGAGAAGTTCCAGGAGC
GAATGGTCGCCGTGGCCAGTTCCAGCGGCAGCCTGAAGAAGATGCTCGCC
AGCTGGGCCAAGGGCATCACGCTGAAGCACTACATGGTGAGTCAAGGCAA
GAGCTCCGGGGGATTCCGGTACAAGATTGCCAAGTCGCTCATCATGTCCA
AGGTGAAGCAGGCCCTGGGCTTCGATCGCGTCCTTACACTGGCCAGTGCG
GCAGCTCCCATGTCGCCGGAGACGAAGAAGTACTTCCTCAGTCTGGACCT
GAAGATTGTCGATGCCTTCGGCATGTCGGAGACGGCCGGTTGCCACACCA
TCTGCCTTCCCGATTCTGTGGGCCTGAACACAATTGGCAAAACTTTGCCC
GGCTGCGAGTCCAAGTTCATCAACAAGGATGCCAACGGTCACGGAGAGCT
GTGCATCCGAGGACGTCATGTTTTCATGGGCTACATCGACAACAAGGAGA
AGACCGAGGAGTCGCTGGATGACGACTGCTGGCTGCATTCCGGTGATTTG
GGATTTGTTGATGACAAGGGTTATGTTTCACTGACGGGACGATCCAAGGA
GATCATCATTACCGCCGGCGGCGAGAACATTCCGCCAGTGCACATCGAGA
ACACGATCAAGAAGGAGTTGGATGCCATTTCCAATGCCTTTTTGGTGGGC
GAGCAGCGCAAATATCTCACTGTTCTGATCACCCTTAAGACCGAAGTGGA
CAAGGATTCCGGTGAGCCGCTGGACGAGCTTAGCCACGAGTCCTCCGTGT
GGGTGAAATCGCTGGGAGTGGAGCACAAGACCGTATCGGATATCCTGGCC
GCAGGTCCCTGCCCCAAGGTGTGGAAGTCCATCGAGGATGCCATCAAGCG
GGCCAACAAGCAGTCCATTTCCAATGCCCAAAAGGTTCAGAAGTTCACCA
TTCTGCCGCACGACTTCTCCATTCCCACCGGCGAACTTGGACCCACCCTA
AAGGTTAAGCGCAACGTTGTGTCCAAGATGTATGCCGATGAGATCGAGAA
ACTATATGCCTAGATTTCTCACTGCAAGATCGAAACCGATGATAGCCGCG
GAACTTGAGCTTTAATGTGAATTTGAATTTAACGGACTTCCAAGCCAATT
GAGTGCCACTTTTATTTTGATTTAGGCTGATGTTAACTGTTGGATATTAA
ACTAAGAACAACTATGGCCCTATGCCTAGGTAGACACGAGCTTGCCAACG
ATTAGGTCCAGAGATCATTTAATTAGTAACTAAGTTTTATTTTTTATATA
CTATTTGGTTGTACCAACTGAACAAACGAAAATTGTTTATTGTCTGAAGA
GCAACAATAAATTTGTAATTAGATTAACTACCAAAAAAAAAAAAAAAAAA
AAAAAAA

FI05443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-RA 2500 bgm-RA 19..2500 1..2482 12140 99.2 Plus
bgm.a 2527 bgm.a 199..2527 154..2482 11375 99.2 Plus
bgm.b 2478 bgm.b 172..2478 176..2482 11265 99.2 Plus
bgm.a 2527 bgm.a 19..171 1..153 765 100 Plus
bgm.b 2478 bgm.b 19..171 1..153 765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14017447..14018091 1838..2482 3195 99.7 Plus
chr2L 23010047 chr2L 14016797..14017389 1247..1839 2785 98 Plus
chr2L 23010047 chr2L 14015301..14015801 747..1247 2475 99.6 Plus
chr2L 23010047 chr2L 14014896..14015241 402..747 1730 100 Plus
chr2L 23010047 chr2L 14014551..14014798 154..401 1210 99.2 Plus
chr2L 23010047 chr2L 14012533..14012685 1..153 765 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-RC 2001 CG4501-PC 1..2001 163..2163 9750 99.2 Plus
bgm-RA 2001 CG4501-PA 1..2001 163..2163 9750 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-RA 2501 CG4501-RA 20..2501 1..2482 12140 99.3 Plus
bgm-RC 2464 CG4501-RC 136..2464 154..2482 11375 99.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-PC 666 CG4501-PC 1..666 163..2160 3370 100 Plus
bgm-PA 666 CG4501-PA 1..666 163..2160 3370 100 Plus
CG4500-PA 681 CG4500-PA 2..680 202..2157 1476 44.2 Plus
CG3961-PD 654 CG3961-PD 81..650 382..2157 404 23.8 Plus
CG3961-PE 666 CG3961-PE 93..662 382..2157 404 23.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14018684..14019329 1838..2483 3200 99.7 Plus
2L 23513712 2L 14018034..14018626 1247..1839 2785 98 Plus
2L 23513712 2L 14016537..14017037 747..1247 2475 99.6 Plus
2L 23513712 2L 14016132..14016477 402..747 1730 100 Plus
2L 23513712 2L 14015787..14016034 154..401 1210 99.2 Plus
2L 23513712 2L 14013765..14013917 1..153 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14018684..14019329 1838..2483 3200 99.6 Plus
2L 23513712 2L 14018034..14018626 1247..1839 2785 97.9 Plus
2L 23513712 2L 14016537..14017037 747..1247 2475 99.6 Plus
2L 23513712 2L 14016132..14016477 402..747 1730 100 Plus
2L 23513712 2L 14015787..14016034 154..401 1210 99.1 Plus
2L 23513712 2L 14013765..14013917 1..153 765 100 Plus
2L 23513712 2L 14028714..14028786 1695..1767 170 82.1 Plus
2L 23513712 2L 14027689..14027748 838..897 150 83.3 Plus
Blast to na_te.dros performed 2014-11-27 04:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 1321..1371 98..148 120 70.6 Plus

FI05443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:22:24 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14017449..14018091 1840..2482 99   Plus
chr2L 14016798..14017389 1248..1839 97 -> Plus
chr2L 14015302..14015801 748..1247 99 -> Plus
chr2L 14014896..14015241 402..747 100 -> Plus
chr2L 14014551..14014798 154..401 99 -> Plus
chr2L 14012533..14012685 1..153 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:50:50 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 1..2001 163..2163 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:29 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 1..2001 163..2163 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:34:05 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 1..2001 163..2163 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:12 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 1..2001 163..2163 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:24 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 1..2001 163..2163 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:06 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 18..2499 1..2482 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:29 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 18..2499 1..2482 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:05 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 20..2501 1..2482 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:07:55 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 18..2499 1..2482 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:24 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 20..2501 1..2482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:22:24 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14018686..14019328 1840..2482 99   Plus
2L 14018035..14018626 1248..1839 97 -> Plus
2L 14016538..14017037 748..1247 99 -> Plus
2L 14016132..14016477 402..747 100 -> Plus
2L 14015787..14016034 154..401 99 -> Plus
2L 14013765..14013917 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:05 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14018686..14019328 1840..2482 99   Plus
arm_2L 14018035..14018626 1248..1839 97 -> Plus
arm_2L 14016538..14017037 748..1247 99 -> Plus
arm_2L 14016132..14016477 402..747 100 -> Plus
arm_2L 14015787..14016034 154..401 99 -> Plus
arm_2L 14013765..14013917 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:56 Download gff for FI05443.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14018686..14019328 1840..2482 99   Plus
2L 14018035..14018626 1248..1839 97 -> Plus
2L 14016538..14017037 748..1247 99 -> Plus
2L 14016132..14016477 402..747 100 -> Plus
2L 14015787..14016034 154..401 99 -> Plus
2L 14013765..14013917 1..153 100 -> Plus

FI05443.pep Sequence

Translation from 162 to 2162

> FI05443.pep
MSTIDALYNRPGPNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPG
LLKRTVNNYGDYPALRTKNGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEE
HHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQ
IVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGYYRWSEIE
SMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDV
RGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDA
LKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAK
GITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPM
SPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCES
KFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVD
DKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRK
YLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPC
PKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKR
NVVSKMYADEIEKLYA*

FI05443.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14276-PA 666 GF14276-PA 1..666 1..666 3344 91.4 Plus
Dana\GF14277-PA 681 GF14277-PA 4..680 16..665 1593 45 Plus
Dana\GF10802-PA 704 GF10802-PA 131..700 74..665 423 24.5 Plus
Dana\GF12373-PA 736 GF12373-PA 86..735 21..666 311 22.9 Plus
Dana\GF19420-PA 598 GF19420-PA 132..516 104..533 269 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23906-PA 666 GG23906-PA 1..666 1..666 3542 98.5 Plus
Dere\GG23907-PA 681 GG23907-PA 2..680 14..665 1555 43.9 Plus
Dere\GG13448-PA 704 GG13448-PA 131..700 74..665 425 24.3 Plus
Dere\GG23376-PA 820 GG23376-PA 170..819 21..666 307 22.6 Plus
Dere\GG24306-PA 593 GG24306-PA 53..498 52..532 295 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11132-PA 668 GH11132-PA 7..668 5..666 3104 84.4 Plus
Dgri\GH11133-PA 685 GH11133-PA 12..684 16..665 1516 44.1 Plus
Dgri\GH16966-PA 704 GH16966-PA 131..700 74..665 400 23.7 Plus
Dgri\GH11457-PA 600 GH11457-PA 77..533 78..563 296 25.3 Plus
Dgri\GH20089-PA 737 GH20089-PA 153..736 74..666 288 22.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-PC 666 CG4501-PC 1..666 1..666 3452 100 Plus
bgm-PA 666 CG4501-PA 1..666 1..666 3452 100 Plus
CG4500-PA 681 CG4500-PA 2..680 14..665 1522 44.2 Plus
CG3961-PD 654 CG3961-PD 81..650 74..665 420 23.8 Plus
CG3961-PE 666 CG3961-PE 93..662 74..665 420 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12714-PA 668 GI12714-PA 7..668 5..666 3043 82.6 Plus
Dmoj\GI12736-PA 674 GI12736-PA 2..673 14..665 1525 44.2 Plus
Dmoj\GI11830-PA 704 GI11830-PA 131..700 74..665 411 24.2 Plus
Dmoj\GI18805-PA 715 GI18805-PA 131..714 74..666 318 23 Plus
Dmoj\GI21922-PA 598 GI21922-PA 54..536 52..566 279 24.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21255-PA 666 GL21255-PA 1..666 1..666 3338 91.3 Plus
Dper\GL21256-PA 689 GL21256-PA 11..688 16..665 1534 44.2 Plus
Dper\GL25251-PA 637 GL25251-PA 131..613 74..550 322 25.8 Plus
Dper\GL17113-PA 738 GL17113-PA 88..737 21..666 302 21.4 Plus
Dper\GL25909-PA 594 GL25909-PA 53..532 52..563 294 25.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18225-PA 666 GA18225-PA 1..666 1..666 3334 91.3 Plus
Dpse\GA18224-PA 689 GA18224-PA 11..688 16..665 1537 44.2 Plus
Dpse\GA17806-PA 704 GA17806-PA 131..700 74..665 421 24.8 Plus
Dpse\GA21288-PC 707 GA21288-PC 57..706 21..666 303 21.6 Plus
Dpse\GA21288-PB 715 GA21288-PB 65..714 21..666 302 21.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15457-PA 666 GM15457-PA 1..666 1..666 3569 99.5 Plus
Dsec\GM15459-PA 681 GM15459-PA 2..680 14..665 1565 44.5 Plus
Dsec\GM14916-PA 704 GM14916-PA 131..700 74..665 426 24.3 Plus
Dsec\GM21055-PA 547 GM21055-PA 65..536 21..475 217 22.7 Plus
Dsec\GM12014-PA 686 GM12014-PA 211..604 95..533 189 22 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23948-PA 666 GD23948-PA 1..665 1..665 3565 99.5 Plus
Dsim\GD23949-PA 533 GD23949-PA 7..532 162..665 1228 45.6 Plus
Dsim\GD12324-PA 704 GD12324-PA 131..700 74..665 425 24.3 Plus
Dsim\GD10588-PA 715 GD10588-PA 65..714 21..666 310 22.6 Plus
Dsim\GD22652-PA 593 GD22652-PA 53..496 52..530 287 23.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18165-PA 668 GJ18165-PA 7..668 5..666 3146 86.1 Plus
Dvir\GJ18167-PA 679 GJ18167-PA 6..678 15..665 1542 44.5 Plus
Dvir\GJ13530-PA 704 GJ13530-PA 131..700 74..665 416 24.3 Plus
Dvir\GJ21833-PA 737 GJ21833-PA 153..736 74..666 320 23.1 Plus
Dvir\GJ18668-PA 699 GJ18668-PA 47..698 21..666 284 21.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15027-PA 666 GK15027-PA 1..666 1..666 3232 88.9 Plus
Dwil\GK15028-PA 691 GK15028-PA 14..690 15..665 1600 45.2 Plus
Dwil\GK20440-PA 704 GK20440-PA 131..700 74..665 417 24.2 Plus
Dwil\GK15099-PA 588 GK15099-PA 21..536 14..566 303 25.3 Plus
Dwil\GK21733-PA 715 GK21733-PA 131..714 74..666 300 22.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19019-PA 666 GE19019-PA 1..666 1..666 3558 98.9 Plus
Dyak\GE19020-PA 681 GE19020-PA 2..680 14..665 1520 43.9 Plus
Dyak\GE22800-PA 704 GE22800-PA 131..700 74..665 426 24.3 Plus
Dyak\GE22550-PA 704 GE22550-PA 131..700 74..665 426 24.3 Plus
Dyak\GE19217-PA 736 GE19217-PA 86..735 21..666 307 22.6 Plus

FI05443.hyp Sequence

Translation from 162 to 2162

> FI05443.hyp
MSTIDALYNRPGPNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPG
LLKRTVNNYGDYPALRTKNGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEE
HHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQ
IVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGYYRWSEIE
SMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDV
RGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDA
LKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAK
GITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPM
SPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCES
KFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVD
DKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRK
YLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPC
PKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKR
NVVSKMYADEIEKLYA*

FI05443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-PC 666 CG4501-PC 1..666 1..666 3452 100 Plus
bgm-PA 666 CG4501-PA 1..666 1..666 3452 100 Plus
CG4500-PA 681 CG4500-PA 2..680 14..665 1522 44.2 Plus
CG3961-PD 654 CG3961-PD 81..650 74..665 420 23.8 Plus
CG3961-PE 666 CG3961-PE 93..662 74..665 420 23.8 Plus