Clone FI05478 Report

Search the DGRC for FI05478

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:54
Well:78
Vector:pOT2
Associated Gene/TranscriptCG9801-RA
Protein status:FI05478.pep: gold
Sequenced Size:3485

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9801 2008-08-15 Release 5.9 accounting
CG9801 2008-12-18 5.12 accounting

Clone Sequence Records

FI05478.complete Sequence

3485 bp assembled on 2008-07-17

GenBank Submission: BT044226.1

> FI05478.complete
CAGGAACGTCGGTCCGCGGCGGAAACAGTCGTTAGCAGTTCCATTTCGTA
GCGACATTAATTGGTAACCATTGGGACTCGAAGTGCAACACACAAAAGTG
GACTGTGCAGCGCGATTTATGTTAGTATTCCATGCAGAAGCCGAAGTTCT
GGGCGATGGAACCACCCTCCGGCAAATGTTAAATATTTATACACACCACC
AACGGAACGCACGCACTTACATATATTTCCCCATTGCAAGTGGCGCCAAC
ATATGTAAAGTAGCGATAAGAAAACAACCCAGAAGAGGAAGGCACACTTA
TTGGTCGGCGGCTGGATTCGTTTGGAGTGACTCGACTCCCACAACAATTG
CCACTGATGAGGTGAACGAACTGGTCAGCATCCCAGCATCCATTTTTTAG
CCCCTCCATCTCTGGCAATTAAGAGAACCCTAACTGGAGGGCGAGAACTG
CTGGCGAGGAGGAGGGAGCAACTCGACTAAAGATGCCGTCGCTGCGCCAG
AAAGTCACCACTTACTTCCGCCAGTTGAGCTTCATCGCGGAGCCTCGCGA
GGGTCGCCGGCGGGCCAGCGAGCACGAGGATGATGATGGTAGCTTCATAA
CTAAATATCTGGAGGGCCGAATGCAGCGTCAGTTTGTTGAGGGTCCGGAG
ATTTACAATGGCCAGAATCCCACGGACATGCCCGTTCTCAAGTTGGATAC
ATACGAAGCTGGAAACTGCTCTATAACAGCCGCCTGCACAGGTCCTGACG
AGGGGCTCACCGGCATCAAGCGCTCCAAACTGCACTTGAGCACCAGCTTC
GCGGATGACATTGACTTCATAGATACGCAGCAGGAGAACGATGATTGCTA
TGGCGTTAGGAGGAGTACACCACCAGTTCAGGTGGCCACACAGAACTCAA
CCCGACTTACCAGCAAATTCGGACGGCCGCCGGCAGGACCTCGCAGACAG
AGCAGTGCGGAGCAGCCCTCCGGATCTGCTTCTGCGTCGGGAATGCGTTC
CCGCAAGAATTCCAAAAGCAGCATAGCCAATCTGGCCGCTGCGTCTGCTG
GCACGGATGCTGGAAAAGCCAACAGCGATCAGAACAATAGGAATGTGTTA
AATGCAAAGACTGAGGTCTCGACGGATGGGGATCCCAACTCAGAGCGGGA
ACGTTTGCTCCGCGAAGCTGTAAGCAACCAGGGTGGCTCTGATCCCGCAG
CTTTGATCGCTGGCGTGGAGAACTGGCGCATGGAGTGCGACTTCGCATAT
GGTATCTCGGTGTCCCTCTACGAGACCAACATGCTGACTAAAGAACCCAT
GGGCAATCCCATCGCCGACTGCTACGGAATGGTAGTGCGCGGAGACTCAG
CTGCCATGGCCATGGCAGATGGTGTCAACTGGGGTGATGGCGCTCGTCTG
GCCGCCCGTTCAGCTGTTCACGGTTGTTTGGACTATCTGGACCGGGCGGT
CTTCGGACAGGCGCTGGAGTGCCGAGCCACCACAACCCAGGAGGTTTTTG
TGAGTTTGCTGCGTAGTCTTTGGGAGGGACACGGTTGTATCCTGGAAGTT
GGAGGAGCCCTATCTACTCTCACCATAGCCGTTGTGCTGCCGCTGGACGG
AGCGCCAGGGAAATATGTCGTGTGCTCGTGTAATGTTGGCGATTCCCTGG
GCTATGTGTACTCCAAGAAGCACGGAGTACGGGAACTAACACAGGCATCC
CACGACATCAGTTCCATGAGGGACATGCGCGATGCGTTGGGTGCCCTTGG
ACCGGCGGATGGCAACAAGCCAGAGCTGAGCAATCTAACCTTCTCGATGA
CCTGCATTGAAAGTGGAGACATAGTCTTTTTAACGTCGGATGGAATCAGC
GATAACTTCGATCCAGTTGTGGGCAAGTTTGCCGAAGCCTGGACTCCGGA
TGTTAAGCTTCAGACGTCGGGACATGTCAAGCCCGCCAACTTGGCACCCA
AACGGCAGAACAAGAGTGCATCCGCCATCTATGCCCGTCTGCATCCTTCG
ACTCCGCCCACGCGACCAGCTCGTCAGTCCAAGGCGGAAAGTCCGCCTAA
TAATGCGCCTAGTCGACCAAAGTATATGCGCTCCCAAACGCTTATTGAAC
CACGCCAGGGATTGGTATCAGCTCCACCGCCATCGGTGGTGCCCCAACGC
ATTCCGAAGTCCATTTCAGGACTGCCCCTTGTTACCGGTCCCCAGCGGCA
TGCTCTTACCCTCTACCGCTTAGAGGATCTGCTCAGCTATGGCATCAACG
GCACGTTTTCGCCCTGCGTATCGGCACGCAGGCTCTGCCACTTGCTTATC
GATTTTGTACGGATGATAACGTCAGCCAGGAGGAAGACCCTGGAGCAAAG
GGAACTCTTCTATAAACTCTCTACGGGACCAGATGGCGCCAAGCGTGAGG
TGCAACTGAACCGCATGCAGCATCGCGCGGCCAGGAAGCGTGTGGTGGAC
AGCAGCGCCTTTGTAGCATTGCCCGGGAAATTGGATCATGCCACTGTGAT
GGCCTACACGGTGGGCGGCGGAGAGGAGCACAATAATGGAAATGAAAACG
GCGATGGGGGAGCTATTTCGCCTGTACTGCAATCCAAGGAGTTCAAGGAG
ACGAATTTCTGAATTGGAGGAAACGCTAGACTGCCGACTAAGCTTTTTAT
ACATTTTTCTCACGCATCTCCGGCATGGGTAGTTCTATCTCAAAAGTAAA
AACCATTCTCTTTAGGGCCTTGAATAAACTAGAATTATATTATGTTTTGA
TTTTTTAATAACATATTTATACATGAAGTGCCAATTCATTTTATATCGTA
ATAGACCTACAATATATTGTTGAATTATTTGCCACAAAGTTTGTGAAATT
TTCAAAATTTTATTTTTATTTTTGTACAAGTTTAATAACTAAATAGTTTC
ACCCAACAAAAAGGTGAATTACTCGTAAATATTTAAGGACCCTTCAGAGA
ATCGTTGGTGTCTTTGATCAAGAAATACCCATTTGGAATCATATATATAT
ATATATTTACGTAAGCATACATACACGGTGATATATCTCACATGTAACTT
CGATATTCATATAGCTTTCGCTTAAGTTCGTTGATTTCAATTTGGTGTTC
TCATTCGTCAGCCATAGTTTTTAGCCATTTATTTGTAAATTGCAAACGAC
AGAAATGCCTCAAATGTTTAAAACTACCAAAAATAATAAGAATACACAAA
TGTACACCGTATTTTTACACTCTCATTCGTAATTCAATGTATATGCCACT
TTTACACCAGTGCTACAATGTGAATTAATAAGATATACTCTTTGTAATAC
CAGCTGTCTCATACAATTTCAAATGTGGTAACGCATATAAATAGTTGGTA
ACGCACAGCTAAAGTTGCTAAATGGGCTGTGGCAAACGGGCCTGGGCAAT
AAATAATTGAGTAAACGCATTAAAAAATTGCGCTTTTACAAACACCAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI05478.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-RA 3504 CG9801-RA 59..3504 1..3446 17185 99.9 Plus
CG9801-RB 3327 CG9801-RB 182..3327 301..3446 15685 99.9 Plus
CG9801-RC 3322 CG9801-RC 178..3322 302..3446 15680 99.9 Plus
CG9801-RC 3322 CG9801-RC 59..179 1..121 605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4561845..4564675 3446..616 14110 99.9 Minus
chr3R 27901430 chr3R 4564744..4565057 616..303 1570 100 Minus
chr3R 27901430 chr3R 4573309..4573611 303..1 1515 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-RC 2130 CG9801-PC 1..2130 483..2612 10650 100 Plus
CG9801-RB 2130 CG9801-PB 1..2130 483..2612 10650 100 Plus
CG9801-RA 2130 CG9801-PA 1..2130 483..2612 10650 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-RA 3476 CG9801-RA 31..3476 1..3446 17185 99.9 Plus
CG9801-RB 3327 CG9801-RB 182..3327 301..3446 15685 99.9 Plus
CG9801-RC 3294 CG9801-RC 150..3294 302..3446 15680 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-PC 709 CG9801-PC 1..709 483..2609 3418 100 Plus
CG9801-PB 709 CG9801-PB 1..709 483..2609 3418 100 Plus
CG9801-PA 709 CG9801-PA 1..709 483..2609 3418 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8735872..8738709 3453..616 14130 99.9 Minus
3R 32079331 3R 8738778..8739091 616..303 1570 100 Minus
3R 32079331 3R 8747343..8747645 303..1 1515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8476703..8479540 3453..616 14130 99.8 Minus
3R 31820162 3R 8479609..8479922 616..303 1570 100 Minus
3R 31820162 3R 8488174..8488476 303..1 1515 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:37:42 has no hits.

FI05478.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:42:42 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4573310..4573611 1..302 100   Minus
chr3R 4564744..4565057 303..616 100 <- Minus
chr3R 4561845..4564674 617..3446 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:06 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RC 1..2130 483..2612 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:59 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RC 1..2130 483..2612 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:04 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 1..2130 483..2612 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:20 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RC 1..2130 483..2612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:42 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 1..2130 483..2612 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:06 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 6..3451 1..3446 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:59 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 6..3451 1..3446 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:04 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 31..3476 1..3446 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:20 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 6..3451 1..3446 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:42 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 31..3476 1..3446 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:42:42 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8747344..8747645 1..302 100   Minus
3R 8738778..8739091 303..616 100 <- Minus
3R 8735879..8738708 617..3446 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:04 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4573066..4573367 1..302 100   Minus
arm_3R 4564500..4564813 303..616 100 <- Minus
arm_3R 4561601..4564430 617..3446 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:50 Download gff for FI05478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8488175..8488476 1..302 100   Minus
3R 8479609..8479922 303..616 100 <- Minus
3R 8476710..8479539 617..3446 99 <- Minus

FI05478.pep Sequence

Translation from 482 to 2611

> FI05478.pep
MPSLRQKVTTYFRQLSFIAEPREGRRRASEHEDDDGSFITKYLEGRMQRQ
FVEGPEIYNGQNPTDMPVLKLDTYEAGNCSITAACTGPDEGLTGIKRSKL
HLSTSFADDIDFIDTQQENDDCYGVRRSTPPVQVATQNSTRLTSKFGRPP
AGPRRQSSAEQPSGSASASGMRSRKNSKSSIANLAAASAGTDAGKANSDQ
NNRNVLNAKTEVSTDGDPNSERERLLREAVSNQGGSDPAALIAGVENWRM
ECDFAYGISVSLYETNMLTKEPMGNPIADCYGMVVRGDSAAMAMADGVNW
GDGARLAARSAVHGCLDYLDRAVFGQALECRATTTQEVFVSLLRSLWEGH
GCILEVGGALSTLTIAVVLPLDGAPGKYVVCSCNVGDSLGYVYSKKHGVR
ELTQASHDISSMRDMRDALGALGPADGNKPELSNLTFSMTCIESGDIVFL
TSDGISDNFDPVVGKFAEAWTPDVKLQTSGHVKPANLAPKRQNKSASAIY
ARLHPSTPPTRPARQSKAESPPNNAPSRPKYMRSQTLIEPRQGLVSAPPP
SVVPQRIPKSISGLPLVTGPQRHALTLYRLEDLLSYGINGTFSPCVSARR
LCHLLIDFVRMITSARRKTLEQRELFYKLSTGPDGAKREVQLNRMQHRAA
RKRVVDSSAFVALPGKLDHATVMAYTVGGGEEHNNGNENGDGGAISPVLQ
SKEFKETNF*

FI05478.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16840-PA 713 GF16840-PA 1..713 1..709 3250 85.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17428-PA 709 GG17428-PA 1..709 1..709 3762 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19015-PA 748 GH19015-PA 1..748 1..709 2751 74.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-PC 709 CG9801-PC 1..709 1..709 3681 100 Plus
CG9801-PB 709 CG9801-PB 1..709 1..709 3681 100 Plus
CG9801-PA 709 CG9801-PA 1..709 1..709 3681 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10368-PA 738 GI10368-PA 1..738 1..709 2773 76.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12134-PA 318 GL12134-PA 1..310 1..293 1148 73.6 Plus
Dper\GL12133-PA 102 GL12133-PA 1..102 611..709 445 86.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22045-PA 728 GA22045-PA 1..728 1..709 3203 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26317-PA 401 GM26317-PA 1..400 1..400 2112 98 Plus
Dsec\GM26319-PA 298 GM26319-PA 1..298 412..709 1564 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20848-PA 709 GD20848-PA 1..709 1..709 3736 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24584-PA 744 GJ24584-PA 1..744 1..709 2790 77.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11269-PA 748 GK11269-PA 1..748 1..709 3028 79.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24829-PA 709 GE24829-PA 1..709 1..709 3612 97.9 Plus

FI05478.hyp Sequence

Translation from 482 to 2611

> FI05478.hyp
MPSLRQKVTTYFRQLSFIAEPREGRRRASEHEDDDGSFITKYLEGRMQRQ
FVEGPEIYNGQNPTDMPVLKLDTYEAGNCSITAACTGPDEGLTGIKRSKL
HLSTSFADDIDFIDTQQENDDCYGVRRSTPPVQVATQNSTRLTSKFGRPP
AGPRRQSSAEQPSGSASASGMRSRKNSKSSIANLAAASAGTDAGKANSDQ
NNRNVLNAKTEVSTDGDPNSERERLLREAVSNQGGSDPAALIAGVENWRM
ECDFAYGISVSLYETNMLTKEPMGNPIADCYGMVVRGDSAAMAMADGVNW
GDGARLAARSAVHGCLDYLDRAVFGQALECRATTTQEVFVSLLRSLWEGH
GCILEVGGALSTLTIAVVLPLDGAPGKYVVCSCNVGDSLGYVYSKKHGVR
ELTQASHDISSMRDMRDALGALGPADGNKPELSNLTFSMTCIESGDIVFL
TSDGISDNFDPVVGKFAEAWTPDVKLQTSGHVKPANLAPKRQNKSASAIY
ARLHPSTPPTRPARQSKAESPPNNAPSRPKYMRSQTLIEPRQGLVSAPPP
SVVPQRIPKSISGLPLVTGPQRHALTLYRLEDLLSYGINGTFSPCVSARR
LCHLLIDFVRMITSARRKTLEQRELFYKLSTGPDGAKREVQLNRMQHRAA
RKRVVDSSAFVALPGKLDHATVMAYTVGGGEEHNNGNENGDGGAISPVLQ
SKEFKETNF*

FI05478.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-PC 709 CG9801-PC 1..709 1..709 3681 100 Plus
CG9801-PB 709 CG9801-PB 1..709 1..709 3681 100 Plus
CG9801-PA 709 CG9801-PA 1..709 1..709 3681 100 Plus