Clone FI05486 Report

Search the DGRC for FI05486

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:54
Well:86
Vector:pOT2
Associated Gene/TranscriptCG3764-RA
Protein status:FI05486.pep: gold
Sequenced Size:5124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3764 2008-08-15 Release 5.9 accounting
CG3764 2008-12-18 5.12 accounting

Clone Sequence Records

FI05486.complete Sequence

5124 bp assembled on 2008-07-17

GenBank Submission: BT044228.1

> FI05486.complete
CATAAAGATATCGACGCGTCGTCAGTCCGCGCTAATCGGGGGTCCAACGA
TATTTTATCACACAATGGGTTTTGGTTCCCAAATTGTGGGGCTTAAGGAG
GAGTGACCAGCAAACTAAATGAGGAATTTGTTTTGCTGTTATGAAATTAT
AGATAGGCAAAGTCGAGTTGGACAAGTACAACCTGTAACTACGGAACTTT
CCGGCCAGACAGTTGGCGCTATCGCGAAGCTGCAGTTGAAATTACCCTTT
GTCGCATGCATACGCCGCCCTTTAAATCCAATCGATTCCCCTTCGAGGGC
AGCCAGGTGCGAGTTCTGCTCTACAAAGAGGATGATACTCGGCGATTGCT
CTTCGACTCGAATGCCCTCCAGAAGGTGATGCACAAGGACCAATCGGCCA
CATCCGCATCCATATCATCGACCAGTACGAGTGGCGGGGGAAAGTTCCTT
AAGAATGAGAAGTACACATCGCTGCAGAATGGCAAGATTCCGTCGAAGTC
ACATTCCAGCAATGGTAGCAATTTCATCGAGGTGTGCGCAGAGTACGGCT
ATAAGCACAATCGACCCTCGGGAGCCGACATCACGCCGGTGGGCGAAATG
GTGTTTGGCTCGTTGCCGATGTCCTTTTGCGGAACGGCTCTGAAGGTGCA
CTGGCTGCCGGAACCGTCCAGAATCCTGTGCTCCCAGGTCTACCTGACGC
CCACCAGTAATGGAGGATCTGGCCACTCGCCGTACTCTACGCTCTCCACG
AATAGCCTGGCGACGCCGCGCACATCGATATGCAGCGAGCATGGATCCAT
GGATGGTCTCTCGATGAACTCGTTCTCAATGCCGTTCAGCGTGAGTGTAG
GTCGGCAGATGAGCCTGACGCCACCGCTGGACGTTCCGGCGACGCCGGCT
GATCAGCAGTCACTGTCGATTCATTCGATCGACTCCAGCGGTCCTCGATA
CTCATCAACATACAGCACTGCCACGGATTCGGGCTATTCGGCCAGTGGGA
GTGGCAGTGCAGCTGGAGGGGATCAGTGGTCATATCAGTACTCATCCACG
CGCAGCAGTTTGGGCAGTGTCCTCTCGGATCAGTCGGATGCAATGCGGAA
GCTGAGCATGGACTTGGCGTGCTATACGGGGTCTCCTTACCTGGACGGAT
TTGCCAGCGATGGCTGCCTGCAGCGAAGAATCTCGCGTAATTTGCGCACC
TCCTTCGAGAACGAGCATTCCAAGAACGATTTTATCGGCTTTCTTAGCGA
CAATTACGCATTGAATGGCCCTGTGGTAGCACCAGCAGGAGGCGGAGCTG
GAGGGGGCAGCGAAGGTGGTGGCATGGCTCCACCGCAGTATCGACGAGCG
AGCTATTGTGCGAATGAAACGCGAAGTAATCCGGAAATGGGCAGGAGGCA
GGCCAATCTGCGGCGGCGGGCGAAACTGGGACTGGCCGTGTGTATCTCGA
TGAGTGAGTCCTTCGAAGAGGAGATGGAGCTGTTTTGTAGTGAGCATATT
GCCTTGCTGGAATCTATGCTTAGTCGATTGAGAGCCAGTACAGAACTGGC
TTACATCAACCACAAGAACTTTCTGCAGATCATGTTCCAGGCCTGGCAGG
ATACGCAACAGTGGTTCAGCGATCTCTTCACTGCCCCGCGCATCAAGACA
CCTGTCTGGCTGAGCATCACCACCAGTGGCAGCAAGTACTCCAAGACTGT
GGCCGAGAGATTCATCAAGGAGCTGTGCGACCTACTCTCCTTCGCCGATA
CTAAGGACTCTAATTTTTTTATTAGCACCATGCTGACGGGAATTCTTACT
CATCACCTCGGATGGGTAGCCACCGTGTCCGCCTTCAATAGCTCCGGTTC
TAAACGATCGGAGTCGTCTGCCTCTGCAGCGGCCATTGAGCAGAGGGCAA
AGCTACTCCAAGTTGCCCAGAAGCATCCGTACAATGCGCTGTGGGCCCAG
CTCGGCGACCTTTATGGAGCCATCGGCATGCCGCCGAAGCTGGCTCGCAC
CATTGTGTGTGGAGCAGAGAAGCTCTGGGTAGAGAAGCTGCTAAACGTGC
TCACATACTTTATTCGGTGCAGCGAAGTGCGGCGAGCGGCCAAGCGGGAG
GACTTTAACAAGCAGCTTATTAACGACCTTGCCGCCCAGAGCCAGACGAA
AAATCAAACGGGTACGCAGGAGAGGCACAAGAGTCCACCGACGCAGAAGC
GCGGATTGAGCAGGGCGGCAACCTGCAAACAGAATCTAAATGCAATTGCT
GATGATGCGGACGATGAGAATGGCGAACTGAACATGTACGATAGGGACAA
CGAGGATGGGGACCCAGATGGTTTGGACTCTGGGTCCCTGGACGCCAGCG
ATGGCATGCAGACTCTGAAAAAGAATGAGATTCCCACTGTGTTGGCCTTC
CGAGACTCTCACTTTGTGCAGCAGGAGCTGCGTATCGGAAACTATTTAAT
GGACACAGGTATTGACAAGAAGATGCTGCTGGCGCGGCAGGCACAGCAGT
ACTTTCGTACTGGCAAAGACGGCCGGATCCGTTTGACAGTAACCACGCCG
GATAACGTGGAGCTGTGCATGGAGGAGGAGCAGTCGAGCGGCACTGGCTC
CGTAAGTACAGGTTCCGTGGATGACGGTGCCATCGAGGCCATCGACTATG
AAGACAACGTGGAGGCACCTCCGAAAAAGAATTTCTTTTGGAACATGGTG
CCGGTAGCAGGTGTAAAGGAGGGACTGAGTCTAAGTGATTTGGCCAAGCT
GCAGCAGGGCATTCGGATCATCAACCGCAAACTGGAGCGACGCAGCAGCA
GCTACTCCGTTGAGGGAAACCCCGATCAACAGCAGAGCAAGACTGGAGAA
ACTGGAGTAGGTGACTTTGAGCCCCTGAGTCATGAGAGACGAGCCTCGCA
TTTGTCACTCTCTGATTTGATAACGCAGAACAGCATGGGCAAAAGCGATC
GCATGACATGGGGCATTGAGCCCATAAAAGAAAACGTTAGCCTGGAGGAG
CAGATTCATTTTGATCACTGCCACAAGCTAATCGAGCGTGAGCACGGCAT
CTGTCGACAAACATCCGCAGATAATGGCAACGGAGTAGTCTTCGTCCTGG
GCGACAATGAGCCACTGATCAACCTGAAAAAGAGCAGTGAGGACCTGAGC
GGAGATCAAGATTCTAAGCCAACTCTAATGCTGTGTGCACAACATCAGCG
CACCCACGACAGAAGCAAGCACTCGGGTATGAAGTTCAATTTTGAACAGT
ATCCGCAAATAGCTACCAACTATATGAAGAACAAGAATCTATTGATGTCT
AACTACGATCTGCTAATGGACAAGGTCACCAAACTGGAGGCCAGTGAGGC
AGCTGCCCTAAAGGGTAGCGATAGCACGGCTACACTAGCTGCTAGCAGTA
GCTCCACGGCTGCACTGCTTCCACCGACAACTCCAGTGACTGCGAATAGC
GATCGTTGCGTAGTTTGCAGCAGTGGCGTTGGCATAAATACCTCGGCCAC
CTGGAACCAAACACCTTCCAATGCCACCGAACTGGAATTCGAGACCGATG
AAATGCATTGCTACAATCAAAGCGGGAACGGTAATGGATTCAGCTCAAAG
GCTCTACAATCTGTAAACTCTGCGGCCTCCATAGACACGCTAAAGTCCTC
TGTTGCAGTCGAACCACCAACTCCAACGATCCCAACCCAAATGCAGACCA
CGTACATGCGCAAGCAGCAGCCCAAACGAGTGCCGTCAGGACGCAGTTCC
GTCTCCTCGGTGGCCGCCAAGTGTGCAGCGGTCAACGTGTCTCAGCAGCT
CTTGAAACTGCCTGTTCCGGGCATCAAGGAATTGCCGCAGGACGACGAAT
CTCCAGGCGACCAGCTGCGTGCCGGCTTCATTCCCTCGCTGCTGTTAAGC
GTTAGCGATCATTACGTCTCAGACATGGTATTGCAGGGTACTTGTGCTCC
GCCCAATAAGTGGGAGATGCATCTGCGGGAGGATCTAGCTCTGGCTGCGC
GCTCAGCCTCGCTAATCTCGCAGCCGGCGGAGAACATTGCAATTGTGGCG
GACATGGACAAGTGGGATGTACGGCTAATTTCATCTCAGACGCAGCAGTT
TCCTTATGCCGGTGGTCAGAGTTCTCCCGTGGGCATGTCTCAGCTAGTGT
CCAGCATGCTGGAAACCGTACAGGCCATGAATGCAGGCGGCATACCAGCC
TATGAGTGTTTGTCGTTCTTGGAGTCCAAGTTACAGGAAATCTACCTACA
ATCGGAAACTTTGGCAGCATTCCTGCTTGAGACTGATCCGTGCCGACTGA
GCGACATTACAAATCCACTGCAGTTGTCCGAAAATGATGTACCATTGCTG
CTGTCAATAGCATATATTCACACGCCCAAGATCAGCCGCAAGTGCGGCAT
CAGCTTCAGGTGACAGGTTGTTGCCGTCTGCTGAGCTAGGACATTGCCAA
ACATTTTATCACTCAACGTTTCAAAGAGCTCTTCTCATGCATCATCCAAA
GCGAAACAAGCAAATACTCCAGCGAATTTTAATTTCACTGATTTTGTGAT
ATATTTATATATGTGTAGGAATCTAGCGCCTAAATGCAGGATACGTTTAT
GAGCCGTAGCTTAGCCGTAGCCCTCGAACGAAACCAATCCAAACTGAACT
TCAACGATTGGTTTCTGACTATTGTAATCGCCCAGTGTAAATGGGTCCTT
CATCGAAATTTACCACATCCACTCATCGCGGTCACATGAAGAAGTATTGT
AAATCATCTGGGTTAGAATTAGCCGGGCCAGATTGTGTTGGCGATAGTGT
GACGATGATTATGACGACTCCGGCTTAGCAGCACTCGAAACGGGCTGCTA
TCGGATCGATCGATCGCCAGAACATATCTTGCTCCGCCCCCACACTTTTG
TAGTGCATGATTTAGATTTAATAATTTATGACAGCAATAATATAATCGTA
ACATTAATTGAATAAGTTTAGAATACGCTAGGGATGCAGCTACTAAAATG
ATATACGTATGTATAATGCATACTAGAAAACAACTAAAACAACAAACAAA
ATCAAATCAAAATATGTATATATATTTTTGAAGGAGAATATACAATTTTA
AAATGAAAAAAAAAAAAAAAAAAA

FI05486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-RA 5223 CG3764-RA 28..5134 1..5107 25535 100 Plus
CG3764.a 5183 CG3764.a 139..5094 152..5107 24780 100 Plus
CG3764.a 5183 CG3764.a 91..142 1..52 260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16985458..16987628 3937..1767 10765 99.7 Minus
chr3L 24539361 chr3L 16987969..16988993 1578..554 5080 99.7 Minus
chr3L 24539361 chr3L 16984161..16985061 5105..4205 4460 99.7 Minus
chr3L 24539361 chr3L 16985121..16985392 4206..3935 1330 99.3 Minus
chr3L 24539361 chr3L 16989169..16989442 555..282 1310 98.5 Minus
chr3L 24539361 chr3L 16990946..16991178 281..49 1150 99.6 Minus
chr3L 24539361 chr3L 16987714..16987904 1766..1576 940 99.5 Minus
chr3L 24539361 chr3L 16991652..16991700 49..1 245 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-RC 4158 CG3764-PC 1..4158 256..4413 20790 100 Plus
CG3764-RA 4158 CG3764-PA 1..4158 256..4413 20790 100 Plus
CG3764-RB 4410 CG3764-PB 279..4410 282..4413 20660 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-RA 5195 CG3764-RA 91..5195 1..5105 25525 100 Plus
CG3764-RC 5092 CG3764-RC 139..5092 152..5105 24770 100 Plus
CG3764-RB 6001 CG3764-RB 1178..6001 282..5105 24120 100 Plus
CG3764-RC 5092 CG3764-RC 91..142 1..52 260 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-PC 1385 CG3764-PC 1..1385 256..4410 5921 100 Plus
CG3764-PA 1385 CG3764-PA 1..1385 256..4410 5921 100 Plus
CG3764-PB 1469 CG3764-PB 93..1469 280..4410 5869 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16996014..16998184 3937..1767 10855 100 Minus
3L 28110227 3L 16998525..16999549 1578..554 5125 100 Minus
3L 28110227 3L 16994715..16995617 5107..4205 4515 100 Minus
3L 28110227 3L 16999739..17000012 555..282 1370 100 Minus
3L 28110227 3L 16995677..16995948 4206..3935 1360 100 Minus
3L 28110227 3L 17001516..17001748 281..49 1165 100 Minus
3L 28110227 3L 16998270..16998460 1766..1576 955 100 Minus
3L 28110227 3L 17002222..17002270 49..1 245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16989114..16991284 3937..1767 10855 100 Minus
3L 28103327 3L 16991625..16992649 1578..554 5125 100 Minus
3L 28103327 3L 16987815..16988717 5107..4205 4515 100 Minus
3L 28103327 3L 16992839..16993112 555..282 1370 100 Minus
3L 28103327 3L 16988777..16989048 4206..3935 1360 100 Minus
3L 28103327 3L 16994616..16994848 281..49 1165 100 Minus
3L 28103327 3L 16991370..16991560 1766..1576 955 100 Minus
3L 28103327 3L 16995322..16995370 49..1 245 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:07:41 has no hits.

FI05486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:12:12 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16991652..16991700 1..49 100   Minus
chr3L 16990946..16991177 50..281 99 <- Minus
chr3L 16989169..16989442 282..555 98 <- Minus
chr3L 16987969..16988991 556..1578 99 <- Minus
chr3L 16987714..16987901 1579..1766 99 <- Minus
chr3L 16985459..16987628 1767..3936 99 <- Minus
chr3L 16985121..16985390 3937..4206 99 <- Minus
chr3L 16984161..16985059 4207..5105 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:05 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 1..4158 256..4413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:32 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 1..4158 256..4413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:30:36 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 1..4158 256..4413 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:54:00 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 1..4158 256..4413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:12 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 1..4158 256..4413 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:04 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 5..5109 1..5105 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:32 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 5..5109 1..5105 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:36 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 91..5195 1..5105 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:54:01 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 5..5109 1..5105 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:12 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 91..5195 1..5105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:12 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17002222..17002270 1..49 100   Minus
3L 17001516..17001747 50..281 100 <- Minus
3L 16999739..17000012 282..555 100 <- Minus
3L 16998525..16999547 556..1578 100 <- Minus
3L 16998270..16998457 1579..1766 100 <- Minus
3L 16996015..16998184 1767..3936 100 <- Minus
3L 16995677..16995946 3937..4206 100 <- Minus
3L 16994717..16995615 4207..5105 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:36 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16995322..16995370 1..49 100   Minus
arm_3L 16994616..16994847 50..281 100 <- Minus
arm_3L 16992839..16993112 282..555 100 <- Minus
arm_3L 16991625..16992647 556..1578 100 <- Minus
arm_3L 16991370..16991557 1579..1766 100 <- Minus
arm_3L 16989115..16991284 1767..3936 100 <- Minus
arm_3L 16988777..16989046 3937..4206 100 <- Minus
arm_3L 16987817..16988715 4207..5105 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:33 Download gff for FI05486.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16995322..16995370 1..49 100   Minus
3L 16994616..16994847 50..281 100 <- Minus
3L 16992839..16993112 282..555 100 <- Minus
3L 16991625..16992647 556..1578 100 <- Minus
3L 16991370..16991557 1579..1766 100 <- Minus
3L 16989115..16991284 1767..3936 100 <- Minus
3L 16988777..16989046 3937..4206 100 <- Minus
3L 16987817..16988715 4207..5105 100 <- Minus

FI05486.pep Sequence

Translation from 255 to 4412

> FI05486.pep
MHTPPFKSNRFPFEGSQVRVLLYKEDDTRRLLFDSNALQKVMHKDQSATS
ASISSTSTSGGGKFLKNEKYTSLQNGKIPSKSHSSNGSNFIEVCAEYGYK
HNRPSGADITPVGEMVFGSLPMSFCGTALKVHWLPEPSRILCSQVYLTPT
SNGGSGHSPYSTLSTNSLATPRTSICSEHGSMDGLSMNSFSMPFSVSVGR
QMSLTPPLDVPATPADQQSLSIHSIDSSGPRYSSTYSTATDSGYSASGSG
SAAGGDQWSYQYSSTRSSLGSVLSDQSDAMRKLSMDLACYTGSPYLDGFA
SDGCLQRRISRNLRTSFENEHSKNDFIGFLSDNYALNGPVVAPAGGGAGG
GSEGGGMAPPQYRRASYCANETRSNPEMGRRQANLRRRAKLGLAVCISMS
ESFEEEMELFCSEHIALLESMLSRLRASTELAYINHKNFLQIMFQAWQDT
QQWFSDLFTAPRIKTPVWLSITTSGSKYSKTVAERFIKELCDLLSFADTK
DSNFFISTMLTGILTHHLGWVATVSAFNSSGSKRSESSASAAAIEQRAKL
LQVAQKHPYNALWAQLGDLYGAIGMPPKLARTIVCGAEKLWVEKLLNVLT
YFIRCSEVRRAAKREDFNKQLINDLAAQSQTKNQTGTQERHKSPPTQKRG
LSRAATCKQNLNAIADDADDENGELNMYDRDNEDGDPDGLDSGSLDASDG
MQTLKKNEIPTVLAFRDSHFVQQELRIGNYLMDTGIDKKMLLARQAQQYF
RTGKDGRIRLTVTTPDNVELCMEEEQSSGTGSVSTGSVDDGAIEAIDYED
NVEAPPKKNFFWNMVPVAGVKEGLSLSDLAKLQQGIRIINRKLERRSSSY
SVEGNPDQQQSKTGETGVGDFEPLSHERRASHLSLSDLITQNSMGKSDRM
TWGIEPIKENVSLEEQIHFDHCHKLIEREHGICRQTSADNGNGVVFVLGD
NEPLINLKKSSEDLSGDQDSKPTLMLCAQHQRTHDRSKHSGMKFNFEQYP
QIATNYMKNKNLLMSNYDLLMDKVTKLEASEAAALKGSDSTATLAASSSS
TAALLPPTTPVTANSDRCVVCSSGVGINTSATWNQTPSNATELEFETDEM
HCYNQSGNGNGFSSKALQSVNSAASIDTLKSSVAVEPPTPTIPTQMQTTY
MRKQQPKRVPSGRSSVSSVAAKCAAVNVSQQLLKLPVPGIKELPQDDESP
GDQLRAGFIPSLLLSVSDHYVSDMVLQGTCAPPNKWEMHLREDLALAARS
ASLISQPAENIAIVADMDKWDVRLISSQTQQFPYAGGQSSPVGMSQLVSS
MLETVQAMNAGGIPAYECLSFLESKLQEIYLQSETLAAFLLETDPCRLSD
ITNPLQLSENDVPLLLSIAYIHTPKISRKCGISFR*

FI05486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10491-PA 1376 GF10491-PA 1..1376 1..1385 6007 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15838-PA 1386 GG15838-PA 1..1386 1..1385 6685 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15127-PA 1409 GH15127-PA 1..1409 1..1385 5102 74.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-PC 1385 CG3764-PC 1..1385 1..1385 7152 100 Plus
CG3764-PA 1385 CG3764-PA 1..1385 1..1385 7152 100 Plus
CG3764-PB 1469 CG3764-PB 93..1469 9..1385 7100 99.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12064-PA 1381 GI12064-PA 1..1381 1..1385 5138 74.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20692-PA 628 GL20692-PA 20..628 788..1385 2495 81.6 Plus
Dper\GL20691-PA 796 GL20691-PA 1..337 1..334 1375 80.1 Plus
Dper\GL20691-PA 796 GL20691-PA 496..777 460..741 1178 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17671-PB 1493 GA17671-PB 96..1493 9..1385 5581 81.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24356-PA 1385 GM24356-PA 1..1385 1..1385 7394 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12434-PA 1012 GD12434-PA 1..505 1..505 2684 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13335-PA 1390 GJ13335-PA 1..1390 1..1385 5283 75.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20434-PA 1426 GK20434-PA 1..1426 1..1385 5139 75.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22177-PA 1383 GE22177-PA 1..1383 1..1385 6729 96.4 Plus

FI05486.hyp Sequence

Translation from 255 to 4412

> FI05486.hyp
MHTPPFKSNRFPFEGSQVRVLLYKEDDTRRLLFDSNALQKVMHKDQSATS
ASISSTSTSGGGKFLKNEKYTSLQNGKIPSKSHSSNGSNFIEVCAEYGYK
HNRPSGADITPVGEMVFGSLPMSFCGTALKVHWLPEPSRILCSQVYLTPT
SNGGSGHSPYSTLSTNSLATPRTSICSEHGSMDGLSMNSFSMPFSVSVGR
QMSLTPPLDVPATPADQQSLSIHSIDSSGPRYSSTYSTATDSGYSASGSG
SAAGGDQWSYQYSSTRSSLGSVLSDQSDAMRKLSMDLACYTGSPYLDGFA
SDGCLQRRISRNLRTSFENEHSKNDFIGFLSDNYALNGPVVAPAGGGAGG
GSEGGGMAPPQYRRASYCANETRSNPEMGRRQANLRRRAKLGLAVCISMS
ESFEEEMELFCSEHIALLESMLSRLRASTELAYINHKNFLQIMFQAWQDT
QQWFSDLFTAPRIKTPVWLSITTSGSKYSKTVAERFIKELCDLLSFADTK
DSNFFISTMLTGILTHHLGWVATVSAFNSSGSKRSESSASAAAIEQRAKL
LQVAQKHPYNALWAQLGDLYGAIGMPPKLARTIVCGAEKLWVEKLLNVLT
YFIRCSEVRRAAKREDFNKQLINDLAAQSQTKNQTGTQERHKSPPTQKRG
LSRAATCKQNLNAIADDADDENGELNMYDRDNEDGDPDGLDSGSLDASDG
MQTLKKNEIPTVLAFRDSHFVQQELRIGNYLMDTGIDKKMLLARQAQQYF
RTGKDGRIRLTVTTPDNVELCMEEEQSSGTGSVSTGSVDDGAIEAIDYED
NVEAPPKKNFFWNMVPVAGVKEGLSLSDLAKLQQGIRIINRKLERRSSSY
SVEGNPDQQQSKTGETGVGDFEPLSHERRASHLSLSDLITQNSMGKSDRM
TWGIEPIKENVSLEEQIHFDHCHKLIEREHGICRQTSADNGNGVVFVLGD
NEPLINLKKSSEDLSGDQDSKPTLMLCAQHQRTHDRSKHSGMKFNFEQYP
QIATNYMKNKNLLMSNYDLLMDKVTKLEASEAAALKGSDSTATLAASSSS
TAALLPPTTPVTANSDRCVVCSSGVGINTSATWNQTPSNATELEFETDEM
HCYNQSGNGNGFSSKALQSVNSAASIDTLKSSVAVEPPTPTIPTQMQTTY
MRKQQPKRVPSGRSSVSSVAAKCAAVNVSQQLLKLPVPGIKELPQDDESP
GDQLRAGFIPSLLLSVSDHYVSDMVLQGTCAPPNKWEMHLREDLALAARS
ASLISQPAENIAIVADMDKWDVRLISSQTQQFPYAGGQSSPVGMSQLVSS
MLETVQAMNAGGIPAYECLSFLESKLQEIYLQSETLAAFLLETDPCRLSD
ITNPLQLSENDVPLLLSIAYIHTPKISRKCGISFR*

FI05486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-PC 1385 CG3764-PC 1..1385 1..1385 7152 100 Plus
CG3764-PA 1385 CG3764-PA 1..1385 1..1385 7152 100 Plus
CG3764-PB 1469 CG3764-PB 93..1469 9..1385 7100 99.9 Plus