Clone FI05540 Report

Search the DGRC for FI05540

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:55
Well:40
Vector:pOT2
Associated Gene/TranscriptEs2-RA
Protein status:FI05540.pep: gold
Sequenced Size:1781

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Es2 2008-12-18 5.12 accounting

Clone Sequence Records

FI05540.complete Sequence

1781 bp assembled on 2008-08-28

GenBank Submission: BT044229.1

> FI05540.complete
TAAAACGGTCACACTTTGCTGGCAGACAAAAATATTCACTTTTTATATCT
AAACAAAACAAAGTTATTTACGAAAAAAGCGAGATATAAACGGCAATGAG
CGCCACGACTAGAACACCTGCCACACCGGGGACACCTGGCACTCCCGGCA
GCCTGGCCATGGAAGTGGCCCGCGTCCAGAATTCAGCACTCGCCGAGTTT
AAAAAGCCCACGGCGATGGTGCGCCACAAGAACAAGCCAAAGATCCTTAC
CGAGGAGAAGTACATCGAGGAGATGTCTAAGATCATCCAGCGCGACTTCT
TTCCCGATCTGGAGCGGCTGCGTGCCCAAAACGACTACCTGGACGCGGAG
TCACGGCGCGACTTTGTACAAATGGCCGAGATTCGGGAGCGCTACAGTCT
GGGCAGGATTTCCGGGACAGGAAGAAGCACCAGCCGACGGAATAATGCCA
TGTCCCCGGCCACATTTGAGACACCAGTGAGTCAGGCGAAATGTAGCAAC
ACCCCATTGCCAAATTCCCGGGCCACAGACACACCATTTTCCACGGACGG
CTCCGAGAAGAGCGATGCCGAGGGCAGGGACACCACCGCGAAGCTATCGC
TGGACGCCTTTCTGCAGAAGTACACCAGCGAGGATAACCAGAGCTTTCAG
GAGATCATCGAAACGGCCGAGGCCAAGCTGCGCCAAAAATACGCAGTACT
GTACAACCATGAGAAGCTCTCCGCAGAGCAACTGCAGCGGGCCCTAATGC
TGCCCAGCATAGAAACGCAATTCGAGGAGCCAGATCCGCTGAGAAAGATC
GAAACCTGGAACTACACCAACATGAATTCCATTATGTACGTGCCCGATGG
CGTGGAGTACACAGAGGAGGAGCGCGTCCAGTTGGCCGAACGGAAGCAGA
GCATCCAACACAATGCCACCAGGCTGCCCGATGAGGCAAAGCATCGCGAA
ATGGACACTAAAAAGCTGAATGATGAAGTGCCCCAAAATGGGGCTGGTGG
TGCCACAGCTACTCCGAAGGTACGCGGCTTCGATTTGTTGCGTTCACCAT
CACCGCGACCCGGAGAGGCTTTCTCGCCCATAATGACCTGGGGTGAGATC
GATGGCACTCCCTTTCGCCTGGACGGAGGCGATACCCCATTGCGGCCCAC
ACAAGGACCCTCGTTCCGGATTAATGAGAACTCTCGGCGCGAAAACATCG
CCATCGCTTTGGCCGAAAGGGTCAGCGAAAGGATGCGAAATCAAAAACAA
ATGGCTCTGGATACGGCGCGTCGTAACATTGGCTCACCACTGATACGCAC
CAATATGGAACGGCTGGCCAGCATGTCGCCGGCAGCGCAGCTACTGGCCA
CGGGTAAGCTGGGTATCCGCGGCACGCCCCGATTAAGGCACACACCATCG
CCGATGAGCGGCAGAAAACGAAAGGTTACGCCCGGCGTGGTGAGGAGCAC
CAATACGCCAATACTGGGTGAACCCAAACCCAAACAGCAGGCCAAGATTA
GCACTCCGGCTAAGAACGTTACCATTGATACGGGATCCACGCTCACGGAC
GATCTGCTCAAGATACCCACTAAACGACGCACTGCAGCCGATTTCTTTTA
GTACATAACATTACCCATAACCCAGCTACATTATTCATGTTTAATTTCAT
TAGAGAATACTATACATAGTCCCACAGTGTTGTTACGAATTGTATATTTC
TTATAAATAGATGCCGAGTTGTTGGAAAGAAGAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI05540.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-RA 1782 Es2-RA 9..1741 1..1733 8665 100 Plus
Sptr-RA 1693 Sptr-RA 1648..1693 1733..1688 230 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8353842..8355127 447..1732 6430 100 Plus
chrX 22417052 chrX 8353254..8353700 1..447 2235 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-RA 1506 CG1474-PA 1..1506 96..1601 7530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-RA 1729 CG1474-RA 1..1729 4..1732 8645 100 Plus
Sptr-RA 1143 CG12117-RA 1090..1143 1732..1679 270 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-PA 501 CG1474-PA 19..501 150..1598 2379 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8462064..8463350 447..1733 6435 100 Plus
X 23542271 X 8461476..8461922 1..447 2235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8470162..8471448 447..1733 6435 100 Plus
X 23527363 X 8469574..8470020 1..447 2235 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:06:56 has no hits.

FI05540.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:57:01 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8353843..8355127 448..1732 100   Plus
chrX 8353254..8353700 1..447 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:07 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1506 96..1601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:31 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1506 96..1601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:25 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1506 96..1601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:13 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1506 96..1601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:01 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1506 96..1601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:10 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1732 1..1732 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:31 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1732 1..1732 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:25 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1729 4..1732 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:08:01 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1732 1..1732 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:01 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 1..1729 4..1732 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:57:01 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8462065..8463349 448..1732 100   Plus
X 8461476..8461922 1..447 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:25 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8356098..8357382 448..1732 100   Plus
arm_X 8355509..8355955 1..447 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:58 Download gff for FI05540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8470163..8471447 448..1732 100   Plus
X 8469574..8470020 1..447 100 -> Plus

FI05540.pep Sequence

Translation from 95 to 1600

> FI05540.pep
MSATTRTPATPGTPGTPGSLAMEVARVQNSALAEFKKPTAMVRHKNKPKI
LTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRDFVQMAEIRERY
SLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFST
DGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYA
VLYNHEKLSAEQLQRALMLPSIETQFEEPDPLRKIETWNYTNMNSIMYVP
DGVEYTEEERVQLAERKQSIQHNATRLPDEAKHREMDTKKLNDEVPQNGA
GGATATPKVRGFDLLRSPSPRPGEAFSPIMTWGEIDGTPFRLDGGDTPLR
PTQGPSFRINENSRRENIAIALAERVSERMRNQKQMALDTARRNIGSPLI
RTNMERLASMSPAAQLLATGKLGIRGTPRLRHTPSPMSGRKRKVTPGVVR
STNTPILGEPKPKQQAKISTPAKNVTIDTGSTLTDDLLKIPTKRRTAADF
F*

FI05540.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22366-PA 507 GF22366-PA 1..507 1..501 2015 78.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18251-PA 502 GG18251-PA 1..502 1..501 2363 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23914-PA 502 GH23914-PA 4..502 10..501 1728 70.6 Plus
Dgri\GH12235-PA 502 GH12235-PA 4..502 10..501 1728 70.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-PA 501 CG1474-PA 1..501 1..501 2564 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15770-PA 497 GI15770-PA 4..497 10..501 1585 66.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20312-PA 491 GL20312-PA 4..491 10..501 1850 75 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13212-PA 491 GA13212-PA 4..491 10..501 1849 75 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Es2-PA 499 GM21583-PA 1..499 1..501 2571 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Es2-PA 502 GD16899-PA 22..502 19..501 2469 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18626-PA 492 GJ18626-PA 17..492 23..501 1619 68.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19987-PA 514 GK19987-PA 4..514 9..501 1739 69 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15782-PA 504 GE15782-PA 1..504 1..501 2404 92.1 Plus

FI05540.hyp Sequence

Translation from 95 to 1600

> FI05540.hyp
MSATTRTPATPGTPGTPGSLAMEVARVQNSALAEFKKPTAMVRHKNKPKI
LTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRDFVQMAEIRERY
SLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFST
DGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYA
VLYNHEKLSAEQLQRALMLPSIETQFEEPDPLRKIETWNYTNMNSIMYVP
DGVEYTEEERVQLAERKQSIQHNATRLPDEAKHREMDTKKLNDEVPQNGA
GGATATPKVRGFDLLRSPSPRPGEAFSPIMTWGEIDGTPFRLDGGDTPLR
PTQGPSFRINENSRRENIAIALAERVSERMRNQKQMALDTARRNIGSPLI
RTNMERLASMSPAAQLLATGKLGIRGTPRLRHTPSPMSGRKRKVTPGVVR
STNTPILGEPKPKQQAKISTPAKNVTIDTGSTLTDDLLKIPTKRRTAADF
F*

FI05540.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-PA 501 CG1474-PA 1..501 1..501 2564 100 Plus