Clone FI05595 Report

Search the DGRC for FI05595

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:55
Well:95
Vector:pOT2
Associated Gene/TranscriptCG30015-RA
Protein status:FI05595.pep: gold
Sequenced Size:6195

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30015 2008-08-15 Release 5.9 accounting
CG30015 2008-12-18 5.12 accounting

Clone Sequence Records

FI05595.complete Sequence

6195 bp assembled on 2008-07-17

GenBank Submission: BT044230.1

> FI05595.complete
TTCGGTGCGTTGTCGGTGTTTGGAATTGAATGTTTTTGAAACGGCGATCG
GTGGTCGAGTCGTGTGCCGGTAATTTGTATACGAAAAAAAAACATATTTG
AAAATGCAAGATCGTTGGCAAGTGCTCTCTGCAAAGTGAGTGAGTGATGG
ATGCTTGCGTCCTTCAGTTCTTTTCTGATTCATATCCTGCACCGAGGTGC
AACAGTTGTTTCGTAGTTGGATTCTGAGTGGAAACAATATTTCCATAATA
ATATACATATGTGTGCGTGTTTTCAAAAAGAGGCAAACAAGAAGTGGGAT
TTGTTATTGGAAAGTACAAACAGCGCTCCCATAGACATACACTCGATGCG
GCCGAGCCAGCAAATCCCCGACAAATCTTAAACCAGTTTTAAGATACATA
TTCTTGGTGTCAGTGTGTGCATGTTGATTTTTTCCGGCATTGTTTTCGTT
TATTTTTTTTATACTCCGCGCTGCTGCTGGCTCTGCATCTTTTTTGTGTA
CCCATACCCTTTGCGCCTGCCCCTAATCGCGTTTCCATTTTCTGGCCATC
GTCCAGATCCGAGGTTTTGCTTTTGGGCTCCGCGTGAGCAACAAGTACCC
CCGCCTAGTACCTATACCTATACCTATACCCAGACCCCTGCCATCATCTA
TATCTGTACCCATACCAAGTGCCTGGCCGCGTCTCGCTCCGCCTGCCATC
TGAAAACCCGAAAAACTCGGAAAGAAACGAGCTTAAATTCTAACGAGATC
AGCACGCCAGTTGGTAACTCTGCTCTCCCCAATTGGTCCAATTTGAATGC
GGTACGAAGCACCTCCAGAATCCGGCGAAGATCGCACAAGTAATTCCGAA
AGACCACCAACAAAAGAGATTCGAACAATGTAACGACAACTAAAACGATC
TAAACACAATCGAAAGGCGGAAAATTATTGTATTGCCCAGAAATCAAGTT
GAACAGACGCCAAAAAAGCACTTCAGCGAAATCAGCATGTCTTCCGGCCT
GATGTCGTGTGTAAGGGAAAACTCGCCGCCGCTGGAATCGGAGTTGGATG
CCAGCTGCGCCGGGGGACCATTGTCATTGCCGGCGGGCCGCGCCCACCCG
CACACCCACGGCGCCACCTCAACGCCCATCTCCAGTCCAGGAAACGATGC
CCATCAGTCCCCGACCGCCGAGCATCCAAATCAGCAGCAGCAACAGCAGC
AGCAGAAGCGTCGTCGTTTCCATCCGCTTCGTAACCTGCGTCGCATCTTC
CGGCGACGTACGATTAATAGCTCCACGGACAGTCCAGCATCCTGTCAGTC
GCCAGGACCCGGATCCTGCAACACCTTGCCACCGCCCGCCAGCAGCAGCA
GTGAGAAGAATCTGCGCAGCGGGATCGCCTCGCCAACAGGATCTCCCCTG
AATCCCCAGCAGCTGAAGGAGAACTACCAGACGCAATCGCTGCCCAAGTC
CAAATCGTACGGTTCGCATCGCGATGAGCTGCTAAGTGTGCTTCTGGGCA
AAAAACGGGCCAGCAAGCAGGACCACAGCCAGGTTGCAGTCCAACCCGAT
TCCCAAGCGCAGTCGCAATCGCCGCAGGAAGCCATGTACCAGGCCCAGCG
ACAGCATGGCGGCGTGGCCGTCTTCCCGGATTCACTAGTCCTTAACCGGA
GCAGCTACTTTGCCGAGCAGAGAATCCAACAGCGCCATCTACGCAGCGTG
GGTGACTCCTCGCAGGAACTGGAGTCCAACCTAGGCTTGGGATCAGGATC
AGGATCAGGATCCGGAGCTGGTGGCGCCGCTGACATCTCCGACAGCCAGC
GTAGCCTCAGCGAAGGTCGACTCCTGGATGTGGACGGGGATTACTCTCGG
GATACCCTGTCCCAGTCACATGACAGCGTCTTCTCTGAATCGGCCACAGC
CAGCAGTCTATCCATTGTACTCAAGGCGGAACTCACGGATGTCCTGCGCA
AGCGACGCAACAGACCCGATGCCTCTGACGAGGATTTGGGTCTGCCCCGC
AGCCCGGCTTCTCCGCAACGGCGAGCAGGGGGTGGAACCAGCAGTCGAAA
TACCTCCGGAGTGGGTCACCAATCGCGGGGTCACCAGAGCGAGGTGTCTT
CACTCAGCTTGCACAGTGTCAATAGTGCCGAAGTGGAGACGGAGGACAGC
CAGAGCTCCCATCAATACCGTCATCACTCGCGAGTTTCCACCAGTTCATC
CATCTCGATGGGCTCGGATATACTGCGATCACATCACGAGGACGACGTGG
ACGCCGTGGGCGGAGAACGTCATCGTCTTTCCCATGCGGCGGCCAAGCAC
AAAATGGCCATTAGGCCTGTGAAAAAGAAAGGACCCACCAGGCAGCACCG
GATGACATTGGAGACTTCCATTCCGGAGGCCAATGAGGATGTGCTAAAGA
TTAGCCCTGGATTGAGGGCTGTCCATGAAGCCGATCTCAAGATCAAGACG
CGCTCTTTGCCACCGAAAACTTTAACTGCCATTGCACCGCCGGTTCAGGC
TAACGCCGCCAGCTCGGTGACAACCAAGCGAACCAATACAATCGAGCAGA
GCTCCACCATCACCAGCACCACTAAGACCACAAGCTCGTCCTCCACGACA
TCTCAGATGTTCGGACTTCGAGGTCTGACCAGCAAGAGCAACGCTTTGCT
GGAGAATCGCGGAGAGTCTTCCACGGATGGGGACGACTTCCTGGCCAACG
AGCGGGAGAAGGAGAACGAGAGTGGATTCCTGCGCCGCCTGATCCACCGG
AACTCCAAGAGATCCATAGCCAGGGCCAACGACGGAGTTGAGGATACAGA
TTCCAGCCAGAGCGTGGCCAAGAAGCTGCAGATCTCAACCTCCTGCTTGG
AGGCCGCTGCTCGGGATGCCGTTCAAGTGCCGGACAAGTCACGCAGTGCC
ACATCGCACGAGCAGCACATCCAGGAGACGCGACAAACAATCAAGCGGGA
GATTCACAACGAGGGCAAGCACGGATTGAACGCCATGGTCAGTAACTACG
GTGTGCATCCACATCCACCCACGGCATTAAAGCCGAAATCAGGTCCTGCC
GCCAGGCAGCGATACATGCCCAAGGAACTGGGAGCTGCTCCGCTGGAGAA
GATCACCTCGGGTAACGATGTGACCAACTTGCTGTCGAAGAGCTCGCGGG
GCAACGACACCTTCCAGTCCACCACTTTGGTGCGGGAACAGCAGAACAAA
GTGGAGACCTCAACGCATTTCGAGAGGAAACCAAGGATTGTGGGCTTGAG
TGCCTTCCAGCAGAAGCTATCGCGATCCAGTGACTCAGTGGGCCAGCACT
CCAGCTCCTCCAACTCGTTGGAGACCAGCACGGATGAGCCCTCGCCCCTG
TACTACGAGGAGAAGCAGCGCAAGACAATTGAAAAGTCCCGCAGCTTTCG
AAATTATGAGGACGAGGCTGTGGACTCCACGGCCGTGCACAACAATATGC
CGAGTTTGCCGGATCTGTCGCTAAGTTTTCGTGTGCCTGCCTACCACAAG
CAGGCGCCACAATCGCCCTGTTCCCCGATTTCCTCCAACGCCAAGTGTGT
GTCACTGGGATTCGAGATCAACGACAACAAATTGCTGCAGTCCCGAGCTG
AATCCACGGGCCAGTTGCCATCTGCTGCGAAAATCTCACCGCAAAAGGCC
GCTTCCACAAAGCTAATAGTTAGTAGTCCGGGTTCGGCTGATATCTCCAA
GATCGAGCAGAACATTGACCTTATCGTGAAATCACCTCTGGTGAGCGTTC
TAAGGAAATCCGGTAATGTGGCGGATAAGCTGCCCAAGGAGCAAACTGCT
CCGACCAAACAGCGACCTAAGCTACTCGATTTGGGAGCAAAGATGACAGC
TCCTGCGGCAAATCCAAGTCCCAGCCCGGCAAGTCCTTTGACCAAGAGTG
CCAAGCTCTCGAACAGTCCACCCACCACACCGGCCAAAGGTCAGGGATCC
TCCAACAGCAGTCGCCGGAATTCCAGTAACGTGGAGAATAACGGTGAGCC
GGAGTTCATGAAGATCCAGCTGAATCGCGTGGACCAGGCGCGTCTGCACA
ACAAGACCAATCACTTGGTGCTAGCCAAGAACTTTAAGTCGCCCACGGAG
CGGAGTCAGAGCAACGATGATCTCAGCTTCCGACGGAGCAGCGAAGAAAA
TCTGGCGGGAATCGAGATTGTGGAGCACCCTCAGCCGAAGCCTCTAAGTC
CGGCAATCAGGCCAACGGCACTGGAGCCCAGCTTGAGCAGGCAATTGAAA
TCCGTTAGTGCCACTAGTATGAGGAATAGCTATGGTAGTAGTAGTGAAGG
ATTAGCCACTCCAGTTACTCCAGTCACTACACCAAGCACACCTAAAAGCA
ATGGGTTTTCGAAAAGTATTCTCAGTGCTCCCAAGAACGTAAAGGAAGTT
AAAGATACCAAGGAGCCAGTCAGCCCGAAGGAGCCAGTGAAGAGCAATCG
CCTCTCTCTGGAGGATCGCAAGCGGTTATTCCTCAGCGAAGAGCGAACGA
AGTCAGTGGAGCAGCGCAGGAAGTCCATTACCAAGACAGAAAGCACTGCT
CCACCCACTCCTTCGGTGATTCCAGCCACGCCCGCCATTCCAGTCACTCC
GGTTACTCCCACCTCTCCCGAAATATTCGAGGTCAATGGCAACACTTCAC
CCACCTCCAATCCCGTGGTGTTGCGCAAGAAATCCTTTGCGAGCTGCAAT
GGCAATCCCAGTCCCTCCAAGGACGATCCCACACCCGAGCTGATGAAGGT
CTTTGCCCGCCGTTCACTAAAAGTGAAGGATGATGACGTTGTGACATTGC
CACAGGTACAACCAGCCGCTCCAGTGAGCAGCAACAGTAAGAAGCTGTCG
CCCAGTGGAGGCGGAGGTCAGAGCGTGGATAGCGACAAGGAGAATCAGTC
GAACAGCGAGGAGAAGCTGGACAAGCTGGCGCCCAAGAGCGAGCCCCAGG
CGACCCATCACCCCAGCACCAATCGCAATTCGGTTGCAGACTTCCGCAAT
CTCAACAATAATAACAATAACCATCAGCAGCAACAGAAGGTGCCACCCAA
GGTGGTCACCTACCTGCCCCCCATTAAGACCAGCAATCAGGGCCGCAATA
GCCTGAATAACAATATAAGCAATGGTAATGGGAGTGCAAGGCCCGCTGCT
GAAAGGTTTTCCCTGCAACTGAAGCAGGCCAACCCGACAGCAACTACTCC
AACGTCTCCGGCAGCAGCAACACCTGTTGCAGCACCAACTGCAACATCTG
CAGCAGCAACAGCATCAGTAGCGCCCAGTAAACCCATCGAGAGATCAGCC
ACCGTGGGCGAGTTCAAGGGAATCCACCAGAGACGCGCCGAGTGGGAGCA
GAGGGCCAAGGAGGCGCTAAAGTAATGGATTAGTTATTTGGGATAACCTA
AATACTCCGCCGACCAGACTGTACCTAGCCTAGCTGCAATCCAAGTGCTT
TTGTCTAGTGATGCGCTCTCCTTCAAGCAAATAAAGCCAACTGGGAGGCA
ACAAATAATCAAATTATCATTATAATCGTTAGCTTAAAACCTGTAAAGAA
TCGCAAATGAAATCAAAGTTGAGGGCGCCGGACTGGCGAGGTCATCCAAA
GACAATAGCGACCTGCTCGATTCCGGTGCCCGAAAAACTCGATAGGCAAT
AACTATATACCGATCTTCAAAAAGTGACTAGATTATATTTATTTTTAGTC
TGTTCAGAGTATCGCTTACTATTGAAAGCTTCTCAGTTAGGCTTCGATTC
GAATTTGTTCTGTGCATGTCGAAAAATGTTTTGAAATAAACTAAATTACG
TCTATTAATTGAGAGTCAAGAAAACTGTAAGGACTGTGAGTATAATTACG
CGTAGCAAGGAGCCTGATATTCGAAACATTTGATTTACTTTAAGTTGATA
ATTTGCAAGCTTTTAATTGGTAGAAGAGATTGATTTTACTATTTAGACTA
ACTATTATTACTTATTAGTATCATGTACATGTTTCGAAGACCTTGTTTAT
GTATAATCTATAGAGTCTGTCGAGATTGCAGACCCATATGAATGTAAACG
TGTAGAAATTTAATCATATTCACACCCAAGTGTATGTAAAACATTGCGAG
TGTATAATTGTTTTCGAAGTGTCAAGTTTGTAAATGTACATACAACAAAT
AAAAACGATTTAATAAATATCCAAATAAAAAAAAAAAAAAAAAAA

FI05595.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-RB 6236 CG30015-RB 53..6233 1..6181 30890 99.9 Plus
CG30015-RA 5544 CG30015-RA 213..5541 853..6181 26630 99.9 Plus
CG30015-RC 6328 CG30015-RC 2069..6325 1925..6181 21270 99.9 Plus
CG30015-RC 6328 CG30015-RC 1..1925 1..1925 9625 100 Plus
CG30015-RA 5544 CG30015-RA 78..212 1..135 675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6726665..6730414 6176..2427 18345 99.3 Minus
chr2R 21145070 chr2R 6761447..6762297 852..1 4165 99.5 Minus
chr2R 21145070 chr2R 6736156..6736824 1838..1170 3345 100 Minus
chr2R 21145070 chr2R 6730637..6731076 2363..1924 2170 99.5 Minus
chr2R 21145070 chr2R 6743728..6743915 1170..983 940 100 Minus
chr2R 21145070 chr2R 6750426..6750560 985..851 675 100 Minus
chr2R 21145070 chr2R 6736015..6736104 1926..1837 450 100 Minus
chr2R 21145070 chr2R 6730481..6730546 2427..2362 315 98.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-RF 4428 CG30015-PF 39..4428 986..5375 21950 100 Plus
CG30015-RB 4389 CG30015-PB 1..4389 987..5375 21945 100 Plus
CG30015-RA 4389 CG30015-PA 1..4389 987..5375 21945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-RB 6242 CG30015-RB 67..6242 1..6176 30880 100 Plus
CG30015-RA 5525 CG30015-RA 202..5525 853..6176 26620 100 Plus
CG30015-RF 5363 CG30015-RF 173..5363 986..6176 25955 100 Plus
CG30015-RA 5525 CG30015-RA 67..201 1..135 675 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-PF 1475 CG30015-PF 11..1475 978..5372 5878 99.8 Plus
CG30015-PB 1462 CG30015-PB 1..1462 987..5372 5875 100 Plus
CG30015-PA 1462 CG30015-PA 1..1462 987..5372 5875 100 Plus
CG30015-PE 1510 CG30015-PE 1..1510 987..5372 5816 96.8 Plus
CG30015-PC 1510 CG30015-PC 1..1510 987..5372 5816 96.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10839097..10842851 6181..2427 18760 100 Minus
2R 25286936 2R 10873854..10874705 852..1 4260 100 Minus
2R 25286936 2R 10848593..10849261 1838..1170 3345 100 Minus
2R 25286936 2R 10843074..10843513 2363..1924 2200 100 Minus
2R 25286936 2R 10856124..10856311 1170..983 940 100 Minus
2R 25286936 2R 10862823..10862957 985..851 675 100 Minus
2R 25286936 2R 10848452..10848541 1926..1837 450 100 Minus
2R 25286936 2R 10842918..10842983 2427..2362 330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10840296..10844050 6181..2427 18760 99.9 Minus
2R 25260384 2R 10875053..10875904 852..1 4260 100 Minus
2R 25260384 2R 10849792..10850460 1838..1170 3345 100 Minus
2R 25260384 2R 10844273..10844712 2363..1924 2200 100 Minus
2R 25260384 2R 10857323..10857510 1170..983 940 100 Minus
2R 25260384 2R 10864022..10864156 985..851 675 100 Minus
2R 25260384 2R 10849651..10849740 1926..1837 450 100 Minus
2R 25260384 2R 10844117..10844182 2427..2362 330 100 Minus
Blast to na_te.dros performed 2014-11-27 02:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6821 5188..5272 218 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2658 4934..5272 203 55.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2735..2829 5180..5272 199 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6889 5166..5304 199 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6621..6800 5089..5272 198 60.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2418 5185..5272 197 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2293..2395 5163..5267 196 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6811 5212..5304 196 72.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6645..6833 5075..5272 194 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6951 5163..5316 191 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2436..2525 5188..5277 189 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6864 5163..5264 185 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6788..6908 5163..5288 185 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2428 5188..5267 184 70 Plus
roo 9092 roo DM_ROO 9092bp 1048..1148 5172..5272 181 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6923 5079..5266 175 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2361..2492 5163..5286 174 62.1 Plus
roo 9092 roo DM_ROO 9092bp 1027..1130 5167..5272 174 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1500..1599 5192..5286 172 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2379 5200..5272 158 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1500..1587 5172..5260 154 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1591 5228..5303 154 70.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2778..2860 5180..5264 150 67.4 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 508..573 5192..5260 149 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6790 5234..5304 147 70.8 Plus
roo 9092 roo DM_ROO 9092bp 1059..1148 5216..5302 145 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2796..2927 5163..5293 144 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2539 5006..5246 140 55.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 513..565 5212..5267 138 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2800 5217..5267 137 75.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2390 5229..5304 135 67.1 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3225..3386 5143..5297 128 58.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 115..196 5173..5256 127 64.7 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9145..9226 5173..5256 127 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1536..1587 5185..5239 124 72.7 Plus
roo 9092 roo DM_ROO 9092bp 1052..1163 5154..5260 124 60.7 Plus

FI05595.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:10:16 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6761447..6762297 1..852 99   Minus
chr2R 6750426..6750558 853..985 100 <- Minus
chr2R 6743728..6743912 986..1170 100 <- Minus
chr2R 6736157..6736784 1210..1837 100 == Minus
chr2R 6736016..6736103 1838..1925 100 <- Minus
chr2R 6730637..6731074 1926..2363 99 <- Minus
chr2R 6730481..6730544 2364..2427 98 <- Minus
chr2R 6727633..6730413 2428..5208 99 <- Minus
chr2R 6726665..6727568 5273..6176 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:42 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..4389 987..5375 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:27 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..4389 987..5375 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:46 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RF 31..4428 978..5375 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:52 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..4389 987..5375 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:16 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RF 31..4428 978..5375 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:41 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..6176 1..6176 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:26 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..6176 1..6176 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:46 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 67..6242 1..6176 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:52 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 1..6176 1..6176 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:16 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 67..6242 1..6176 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:10:16 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10873854..10874705 1..852 100   Minus
2R 10862823..10862955 853..985 100 <- Minus
2R 10856124..10856308 986..1170 100 <- Minus
2R 10848594..10849260 1171..1837 100 <- Minus
2R 10848453..10848540 1838..1925 100 <- Minus
2R 10843074..10843511 1926..2363 100 <- Minus
2R 10842918..10842981 2364..2427 100 <- Minus
2R 10839102..10842850 2428..6176 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:46 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6761359..6762210 1..852 100   Minus
arm_2R 6750328..6750460 853..985 100 <- Minus
arm_2R 6743629..6743813 986..1170 100 <- Minus
arm_2R 6736099..6736765 1171..1837 100 <- Minus
arm_2R 6735958..6736045 1838..1925 100 <- Minus
arm_2R 6730579..6731016 1926..2363 100 <- Minus
arm_2R 6730423..6730486 2364..2427 100 <- Minus
arm_2R 6726607..6730355 2428..6176 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:26 Download gff for FI05595.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10875053..10875904 1..852 100   Minus
2R 10864022..10864154 853..985 100 <- Minus
2R 10857323..10857507 986..1170 100 <- Minus
2R 10849793..10850459 1171..1837 100 <- Minus
2R 10849652..10849739 1838..1925 100 <- Minus
2R 10844273..10844710 1926..2363 100 <- Minus
2R 10844117..10844180 2364..2427 100 <- Minus
2R 10840301..10844049 2428..6176 100 <- Minus

FI05595.pep Sequence

Translation from 986 to 5374

> FI05595.pep
MSSGLMSCVRENSPPLESELDASCAGGPLSLPAGRAHPHTHGATSTPISS
PGNDAHQSPTAEHPNQQQQQQQQKRRRFHPLRNLRRIFRRRTINSSTDSP
ASCQSPGPGSCNTLPPPASSSSEKNLRSGIASPTGSPLNPQQLKENYQTQ
SLPKSKSYGSHRDELLSVLLGKKRASKQDHSQVAVQPDSQAQSQSPQEAM
YQAQRQHGGVAVFPDSLVLNRSSYFAEQRIQQRHLRSVGDSSQELESNLG
LGSGSGSGSGAGGAADISDSQRSLSEGRLLDVDGDYSRDTLSQSHDSVFS
ESATASSLSIVLKAELTDVLRKRRNRPDASDEDLGLPRSPASPQRRAGGG
TSSRNTSGVGHQSRGHQSEVSSLSLHSVNSAEVETEDSQSSHQYRHHSRV
STSSSISMGSDILRSHHEDDVDAVGGERHRLSHAAAKHKMAIRPVKKKGP
TRQHRMTLETSIPEANEDVLKISPGLRAVHEADLKIKTRSLPPKTLTAIA
PPVQANAASSVTTKRTNTIEQSSTITSTTKTTSSSSTTSQMFGLRGLTSK
SNALLENRGESSTDGDDFLANEREKENESGFLRRLIHRNSKRSIARANDG
VEDTDSSQSVAKKLQISTSCLEAAARDAVQVPDKSRSATSHEQHIQETRQ
TIKREIHNEGKHGLNAMVSNYGVHPHPPTALKPKSGPAARQRYMPKELGA
APLEKITSGNDVTNLLSKSSRGNDTFQSTTLVREQQNKVETSTHFERKPR
IVGLSAFQQKLSRSSDSVGQHSSSSNSLETSTDEPSPLYYEEKQRKTIEK
SRSFRNYEDEAVDSTAVHNNMPSLPDLSLSFRVPAYHKQAPQSPCSPISS
NAKCVSLGFEINDNKLLQSRAESTGQLPSAAKISPQKAASTKLIVSSPGS
ADISKIEQNIDLIVKSPLVSVLRKSGNVADKLPKEQTAPTKQRPKLLDLG
AKMTAPAANPSPSPASPLTKSAKLSNSPPTTPAKGQGSSNSSRRNSSNVE
NNGEPEFMKIQLNRVDQARLHNKTNHLVLAKNFKSPTERSQSNDDLSFRR
SSEENLAGIEIVEHPQPKPLSPAIRPTALEPSLSRQLKSVSATSMRNSYG
SSSEGLATPVTPVTTPSTPKSNGFSKSILSAPKNVKEVKDTKEPVSPKEP
VKSNRLSLEDRKRLFLSEERTKSVEQRRKSITKTESTAPPTPSVIPATPA
IPVTPVTPTSPEIFEVNGNTSPTSNPVVLRKKSFASCNGNPSPSKDDPTP
ELMKVFARRSLKVKDDDVVTLPQVQPAAPVSSNSKKLSPSGGGGQSVDSD
KENQSNSEEKLDKLAPKSEPQATHHPSTNRNSVADFRNLNNNNNNHQQQQ
KVPPKVVTYLPPIKTSNQGRNSLNNNISNGNGSARPAAERFSLQLKQANP
TATTPTSPAAATPVAAPTATSAAATASVAPSKPIERSATVGEFKGIHQRR
AEWEQRAKEALK*

FI05595.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 14:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11079-PA 1476 GF11079-PA 1..1476 1..1462 4452 71.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 14:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22711-PA 1519 GG22711-PA 1..1519 1..1462 6320 90 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 14:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20714-PA 1488 GH20714-PA 1..1488 1..1462 3615 57.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-PF 1475 CG30015-PF 14..1475 1..1462 7407 100 Plus
CG30015-PB 1462 CG30015-PB 1..1462 1..1462 7407 100 Plus
CG30015-PA 1462 CG30015-PA 1..1462 1..1462 7407 100 Plus
CG30015-PE 1510 CG30015-PE 1..1510 1..1462 7348 96.8 Plus
CG30015-PC 1510 CG30015-PC 1..1510 1..1462 7348 96.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 14:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20798-PA 1505 GI20798-PA 1..1505 1..1462 3307 57.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 14:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20030-PA 1571 GL20030-PA 16..1571 1..1462 3895 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15577-PB 1506 GA15577-PB 1..1506 1..1462 3969 64.5 Plus
Dpse\GA15577-PA 1554 GA15577-PA 1..1554 1..1462 3906 62.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20487-PA 1438 GM20487-PA 1..1438 1..1462 6404 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25949-PA 1508 GD25949-PA 1..1508 1..1462 6527 91.1 Plus
Dsim\GD15260-PA 316 GD15260-PA 1..316 1..319 1345 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20532-PA 1489 GJ20532-PA 1..1489 1..1462 3684 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20969-PA 1483 GK20969-PA 1..1483 1..1462 3267 57.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13068-PA 1507 GE13068-PA 1..1507 1..1462 6390 90.1 Plus

FI05595.hyp Sequence

Translation from 986 to 5374

> FI05595.hyp
MSSGLMSCVRENSPPLESELDASCAGGPLSLPAGRAHPHTHGATSTPISS
PGNDAHQSPTAEHPNQQQQQQQQKRRRFHPLRNLRRIFRRRTINSSTDSP
ASCQSPGPGSCNTLPPPASSSSEKNLRSGIASPTGSPLNPQQLKENYQTQ
SLPKSKSYGSHRDELLSVLLGKKRASKQDHSQVAVQPDSQAQSQSPQEAM
YQAQRQHGGVAVFPDSLVLNRSSYFAEQRIQQRHLRSVGDSSQELESNLG
LGSGSGSGSGAGGAADISDSQRSLSEGRLLDVDGDYSRDTLSQSHDSVFS
ESATASSLSIVLKAELTDVLRKRRNRPDASDEDLGLPRSPASPQRRAGGG
TSSRNTSGVGHQSRGHQSEVSSLSLHSVNSAEVETEDSQSSHQYRHHSRV
STSSSISMGSDILRSHHEDDVDAVGGERHRLSHAAAKHKMAIRPVKKKGP
TRQHRMTLETSIPEANEDVLKISPGLRAVHEADLKIKTRSLPPKTLTAIA
PPVQANAASSVTTKRTNTIEQSSTITSTTKTTSSSSTTSQMFGLRGLTSK
SNALLENRGESSTDGDDFLANEREKENESGFLRRLIHRNSKRSIARANDG
VEDTDSSQSVAKKLQISTSCLEAAARDAVQVPDKSRSATSHEQHIQETRQ
TIKREIHNEGKHGLNAMVSNYGVHPHPPTALKPKSGPAARQRYMPKELGA
APLEKITSGNDVTNLLSKSSRGNDTFQSTTLVREQQNKVETSTHFERKPR
IVGLSAFQQKLSRSSDSVGQHSSSSNSLETSTDEPSPLYYEEKQRKTIEK
SRSFRNYEDEAVDSTAVHNNMPSLPDLSLSFRVPAYHKQAPQSPCSPISS
NAKCVSLGFEINDNKLLQSRAESTGQLPSAAKISPQKAASTKLIVSSPGS
ADISKIEQNIDLIVKSPLVSVLRKSGNVADKLPKEQTAPTKQRPKLLDLG
AKMTAPAANPSPSPASPLTKSAKLSNSPPTTPAKGQGSSNSSRRNSSNVE
NNGEPEFMKIQLNRVDQARLHNKTNHLVLAKNFKSPTERSQSNDDLSFRR
SSEENLAGIEIVEHPQPKPLSPAIRPTALEPSLSRQLKSVSATSMRNSYG
SSSEGLATPVTPVTTPSTPKSNGFSKSILSAPKNVKEVKDTKEPVSPKEP
VKSNRLSLEDRKRLFLSEERTKSVEQRRKSITKTESTAPPTPSVIPATPA
IPVTPVTPTSPEIFEVNGNTSPTSNPVVLRKKSFASCNGNPSPSKDDPTP
ELMKVFARRSLKVKDDDVVTLPQVQPAAPVSSNSKKLSPSGGGGQSVDSD
KENQSNSEEKLDKLAPKSEPQATHHPSTNRNSVADFRNLNNNNNNHQQQQ
KVPPKVVTYLPPIKTSNQGRNSLNNNISNGNGSARPAAERFSLQLKQANP
TATTPTSPAAATPVAAPTATSAAATASVAPSKPIERSATVGEFKGIHQRR
AEWEQRAKEALK*

FI05595.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-PF 1475 CG30015-PF 14..1475 1..1462 7407 100 Plus
CG30015-PB 1462 CG30015-PB 1..1462 1..1462 7407 100 Plus
CG30015-PA 1462 CG30015-PA 1..1462 1..1462 7407 100 Plus
CG30015-PE 1510 CG30015-PE 1..1510 1..1462 7348 96.8 Plus
CG30015-PC 1510 CG30015-PC 1..1510 1..1462 7348 96.8 Plus