Clone FI05606 Report

Search the DGRC for FI05606

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:56
Well:6
Vector:pOT2
Associated Gene/Transcriptbam-RA
Protein status:FI05606.pep: gold
Sequenced Size:1923

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
bam 2008-12-18 5.12 accounting

Clone Sequence Records

FI05606.complete Sequence

1923 bp assembled on 2008-08-28

GenBank Submission: BT044232.1

> FI05606.complete
CAAACGGTAAAAAGAACCTGGCGATAAGGAAAGATTTAAAAGGCAAAAAT
CGAGTGATTTGTGTGATTTAACTTAAGAATAATGCTTAATGCGCGTGACG
TGTGTCCTGAGGGCAACGACGACCAGCAGTTGGACCACAATTTTAAGCAG
ATGGAGGAGCATTTGGCCTTAATGGTGGAAGGCAATGAAAACGAAGATCC
GAGGAAAGCCACTTGTGAGTACGAGGATACGAACGAAGATGGTGCAACCT
GCACATCGGGCGTTTTATCCGAAATCCAGGAGAACTTCGGTAGACTCCGG
TTGTGTGACGTTACTGCACCACTCCTCGAATTCCACGGTTTGGATTGCTT
GCAACAGATTCAAAAGCGCTCGCGCCATTTTGCATTCGACGGTTCTCCGG
CCAAGAAGTCGCGATCCGGAGGCGTGTTGGTCACCGGGCCAAAGCAGAAG
CAACTGCAGAAGGAAAATGTGTGGAACCGGAAGAGTAAAGGCTCTGCGTC
CGCGGATAATATTGAGAAACTGCCCATAACTATTGAGAAACTGCATATGA
TTGGTCTGCACGGCGATTGCTTAGAGCACAACGCCGTGCTGCGTTTGATG
AATCTGTTCAGATCCCTGCATGATCACCTGACCGCCGATTTGGGCTTCTC
GCGCCAAAACTCAATGCCCTCGGACTATCTGTTCGATATGCCGGTGAAGA
GCACGATGCCTAAGAGCTTGAATGTGCGCTACCAACTGCAGGTGCTGTGC
ACCAAAGTAGAGCGCTTCCTTGTCCAGCAGCGCCGCACCTTGGAGGCGAA
TCGCCACTTCGATTTCGAGAAATACGACGAGTGTGACAAGTTGCTTAAGG
GTTTCGCATCCTATTTGGACAACTTCAAACTGCTTTTAAAGCCCAAAATG
CGCAATCGAAACGGAAACTCGGGGAGCAATGCGGACAAGTTCCATACTCA
GCGCATGGAGAGATTGCTAATTGGTCTGCGCGATTGGATCAAGGCTGCGC
ATCTCAGTGTGCACGTATTTAACTGGGAAATGGATCTGGAGCACCGCTAC
TCCGGGGCCATGACCGAAAGCCACAAGTCGTTGAACGAGCGGGCCATCCT
TTTGTCCGGTGCCGAGCTAAGGGCGGCCGAAGCGCGTGGAATCAGTGCGG
AGGATCTGTTCATCGCCCAGAGATACAAACTGGGAGGTCCGATCTATTGC
GTTCTGGAGCAGCATGAGTTCCTCTCCGCTCTGATCGCCAATCCAGAGAC
CTATTTCCCGCCCAGTGTTGTCGCCATTTGCGGGCCACAGAAGCTTGGCG
CAGTGAGCATGGAGCAGCCGTCAGCGTCGGAGGAGGAGTTTGAGGAGACC
GAGGAAGTGCCATCATCGCCACCTCGTCACACCGGACGTGTACCTCGCTT
CAGAAGCTAAACTAATGCTGTGCACATCGATAAAAGAATGACAGCAAATA
TGCAATTTAAAAAAGCTACTCTTCTCATGGGAAGCAATAATTTCGTAAAG
TAAACATATCTATAGTGTAAGATATATTTGTCCAATAGTGCGGACTCCAT
ATTTGTATTCGTGAATAAGCTTATATAAGCTTTTTAAAAATATTTATCAA
ATCGATACAAACAAAATCAAAATGAAAACGATTTATTACCCCTGTTTTGA
GATTGATAACAAATTTATATAAGTTTAACTGTGTTTACATTTATTTGGCA
AAACTACAAATGTGTTTGCTTTTCACTTTTATAAATCTGTATTTTACTTA
AACTTTAGAAATAAGAAATCCTTTAGTGCCTGAATTTATTTTGCAACTAC
GTTTTATTTGTATGAGGAACTTACCAGTTTTTCTTATTTGCTTTGCATTT
GTATTTTGAAAGTCAAATAAATATTTACGATTTGTGTTTGGACTAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

FI05606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
bam-RA 2009 bam-RA 116..2009 1..1894 9455 99.9 Plus
CG11854.a 1040 CG11854.a 814..1040 1896..1670 1135 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21066123..21067076 1894..941 4770 100 Minus
chr3R 27901430 chr3R 21067573..21068141 569..1 2830 99.8 Minus
chr3R 27901430 chr3R 21067138..21067509 940..569 1860 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
bam-RA 1329 CG10422-PA 1..1329 82..1410 6630 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
bam-RA 1894 CG10422-RA 1..1894 1..1894 9455 99.9 Plus
CG11854-RB 1039 CG11854-RB 816..1039 1894..1671 1120 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
bam-PA 442 CG10422-PA 1..442 82..1407 2195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25243037..25243992 1896..941 4780 100 Minus
3R 32079331 3R 25244489..25245057 569..1 2830 99.8 Minus
3R 32079331 3R 25244054..25244425 940..569 1860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24983868..24984823 1896..941 4780 100 Minus
3R 31820162 3R 24985320..24985888 569..1 2830 99.8 Minus
3R 31820162 3R 24984885..24985256 940..569 1860 100 Minus
Blast to na_te.dros performed 2014-11-27 15:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 392..442 1587..1636 135 76.5 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 105..167 1889..1828 114 66.7 Minus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1570..1632 1828..1889 114 66.7 Plus

FI05606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:21:47 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21067573..21068141 1..569 99   Minus
chr3R 21067138..21067508 570..940 100 <- Minus
chr3R 21066123..21067076 941..1894 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:14 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1329 82..1410 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:12:01 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1329 82..1410 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:33 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1329 82..1410 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:20:01 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1329 82..1410 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:21:47 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1329 82..1410 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:09:28 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 106..1999 1..1894 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:12:00 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 106..1999 1..1894 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:33 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1894 1..1894 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:06:44 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 106..1999 1..1894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:21:47 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 1..1894 1..1894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:21:47 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25244489..25245057 1..569 99   Minus
3R 25244054..25244424 570..940 100 <- Minus
3R 25243039..25243992 941..1894 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:33 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21070211..21070779 1..569 99   Minus
arm_3R 21069776..21070146 570..940 100 <- Minus
arm_3R 21068761..21069714 941..1894 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:42:23 Download gff for FI05606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24985320..24985888 1..569 99   Minus
3R 24984885..24985255 570..940 100 <- Minus
3R 24983870..24984823 941..1894 100 <- Minus

FI05606.pep Sequence

Translation from 81 to 1409

> FI05606.pep
MLNARDVCPEGNDDQQLDHNFKQMEEHLALMVEGNENEDPRKATCEYEDT
NEDGATCTSGVLSEIQENFGRLRLCDVTAPLLEFHGLDCLQQIQKRSRHF
AFDGSPAKKSRSGGVLVTGPKQKQLQKENVWNRKSKGSASADNIEKLPIT
IEKLHMIGLHGDCLEHNAVLRLMNLFRSLHDHLTADLGFSRQNSMPSDYL
FDMPVKSTMPKSLNVRYQLQVLCTKVERFLVQQRRTLEANRHFDFEKYDE
CDKLLKGFASYLDNFKLLLKPKMRNRNGNSGSNADKFHTQRMERLLIGLR
DWIKAAHLSVHVFNWEMDLEHRYSGAMTESHKSLNERAILLSGAELRAAE
ARGISAEDLFIAQRYKLGGPIYCVLEQHEFLSALIANPETYFPPSVVAIC
GPQKLGAVSMEQPSASEEEFEETEEVPSSPPRHTGRVPRFRS*

FI05606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17434-PA 444 GF17434-PA 6..444 12..442 821 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\bam-PA 445 GG12273-PA 1..445 1..442 1708 73.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14604-PA 426 GH14604-PA 9..423 13..440 661 37.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
bam-PA 442 CG10422-PA 1..442 1..442 2324 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23668-PA 426 GI23668-PA 9..422 13..439 647 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12616-PA 436 GL12616-PA 4..430 13..441 824 42.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10309-PA 436 GA10309-PA 4..430 13..441 824 42.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17739-PA 441 GM17739-PA 1..441 1..442 1981 85.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\bam-PA 442 GD18222-PA 1..442 1..442 1924 83.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23228-PA 438 GJ23228-PA 9..434 13..439 717 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13839-PA 413 GK13839-PA 5..405 12..437 720 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\bam-PA 442 GE10723-PA 1..442 1..442 1713 74.2 Plus

FI05606.hyp Sequence

Translation from 81 to 1409

> FI05606.hyp
MLNARDVCPEGNDDQQLDHNFKQMEEHLALMVEGNENEDPRKATCEYEDT
NEDGATCTSGVLSEIQENFGRLRLCDVTAPLLEFHGLDCLQQIQKRSRHF
AFDGSPAKKSRSGGVLVTGPKQKQLQKENVWNRKSKGSASADNIEKLPIT
IEKLHMIGLHGDCLEHNAVLRLMNLFRSLHDHLTADLGFSRQNSMPSDYL
FDMPVKSTMPKSLNVRYQLQVLCTKVERFLVQQRRTLEANRHFDFEKYDE
CDKLLKGFASYLDNFKLLLKPKMRNRNGNSGSNADKFHTQRMERLLIGLR
DWIKAAHLSVHVFNWEMDLEHRYSGAMTESHKSLNERAILLSGAELRAAE
ARGISAEDLFIAQRYKLGGPIYCVLEQHEFLSALIANPETYFPPSVVAIC
GPQKLGAVSMEQPSASEEEFEETEEVPSSPPRHTGRVPRFRS*

FI05606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
bam-PA 442 CG10422-PA 1..442 1..442 2324 100 Plus