Clone FI05620 Report

Search the DGRC for FI05620

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:56
Well:20
Vector:pOT2
Associated Gene/TranscriptCG7956-RA
Protein status:FI05620.pep: gold
Sequenced Size:3545

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7956 2008-08-15 Release 5.9 accounting
CG7956 2008-12-18 5.12 accounting

Clone Sequence Records

FI05620.complete Sequence

3545 bp assembled on 2008-07-17

GenBank Submission: BT044234.1

> FI05620.complete
TCATGTCACAAATTTCGTAAACAAAAGAATCGCGAAATTGCTAGTAATAG
TTTTCACTGACTTGGTCTGCTGGTCGGGTAATGTCACAAAAGTAGAGTAG
AAAATCCAGCCATGGAGGTGTTCCAGACCGACTCGCACTATATCTTCGTG
AAGCGGGACAAGAGTTTGTGGTGGCACCGAAGGACGTCTGAGTTCTCCAT
AAAAGCAGGATGGGATCTCAGTTCTGTGGACGACATAGAATGCATTGGCG
TGACACACGGAATTGTTGGTGTAATCTCACTGCCCAATGTCTATGAACCC
CATTTAGTTGTGGTAAAGGAGGCTTCGGCAGTGGGCGTTCTATATCCACC
ACACTTGGTGTACAAAATCAAGTCGATATGCATTCTGAGTGCCGACGATC
CGGACACCGATTTGCCCAATTGCACCAAGCACACCAAGAGCAACCAGTCC
ACGCCCACCCACAGCGTCTCCACCTCCAACAACAACAATGCCAGCGTTCC
GTCGAGCGGCGGAGGCTCCTCAAAGAGCACCAAACTATTCGAAGGCATGA
ACAAGACGTGGGGCGCCGTAAAGAGTGCAGGCAACACTATTAAGAATACT
ACCCAGCAAGCTGCGAATTTGGCCACCAAGCAGGTTAAGTCATCTGTGGG
CATTCGGGAGCCCAGGCATATTGAACGCCGCATAACGGAGGAATTACACA
AGATATTCGACGAGACGGACAGCTTTTATTTCAGCTTCGACTGCGATATC
ACCAACAATCTGCAGCGCCATGAGGCCAAATCGGAGGAAAGTCAGTCTCA
GCCGGATGAGAGATTCTTTTGGAACAAGCATATGATAAGAGATTTGATTA
ACTTGAATGACAAAACTTGGATACTCCCCATCATTCAGGGATTCATGCAA
GTTGAAAATTGTGTCATAGGCAATGAATGCTTCACCTTGGCCTTGGTTTC
GCGAAGATCGCGTCATCGTGCGGGAACACGCTACAAGAGACGGGGCGTAG
ACGAAAAGGGAAACTGTGCCAATTACGTAGAAACGGAACAAATACTCTCA
TTCCGTCATCACCAGCTTTCCTTCACCCAAGTGCGTGGATCTGTGCCTAT
CTACTGGAGCCAGCCGGGCTACAAGTATCGCCCACCACCACGCCTCGATC
GAGGGGTTGCCGAGACCCAACAGGCCTTTGAACTGCACTTTACCAAGGAA
CTGGAGACCTATGGGCGGGTGTGCATCGTCAATTTGGTTGAGCAGAGCGG
AAAGGAGAAGACAATTGGAGATGCTTATGCAGATCACGTGATTAAGTTGA
ACAACGACCGATTGATATATGTAACCTTTGACTTTCACGATTACTGCCGC
GGCATGCGCTTCGAGAATGTGTCGGCTCTAATCGACGCAGTAGGCCCTGA
GGCAGGTGCAATGGGCTTCCACTGGCGGGATCAACGTGGAATGATATGCA
ACCAAAAATCCGTGTTTAGGGTAAATTGCATGGACTGCCTAGATAGAACG
AATGTGGTGCAAACGGCTATTGGCAAGGCTGTACTCGAATCTCAGCTAGT
GAAACTGGGCCTCTCGCCGCCTTATACTCCCATTCCGGAGCAGCTGAAAT
CTCCGTTTATGGTGCTATGGGCAAACAATGGCGACATAATAAGTAGGCAG
TATGCAGGCACAAATGCATTAAAGGGAGACTATACTCGCACCGGTGAGCG
CAAAATCAGCGGTATGATGAAAGACGGCATGAACTCCGCCAATCGTTATT
ATTTGGCGCGATTTAAGGACTCGTATCGACAGGCCACCATAGATTTGATG
CTAGGCAACCAGGTCTCCTCGGAGTCACTCAGTGCTTTGGGCGGACAAGC
TGGCCCAGATGAAAATGACGGAACGGAAAATGCCGAGCAAGCCAAGTTGC
TAGTGGAAGATTGTCGTCGCCTGCTGCTGGGAACTGCTCAGTATCCTGTT
GGAGCTTGGGGACTAATAGATGCTGACCCAAGCTCCGGCGATATCAACGA
AACAGAGGTAGATACTATTTTGTTGCTCACAGACGATTGCTATATTGTTG
CCGAATACGACTCACATCTGGACAAGATTGTGCGCTTTGAGAAGGTGCAA
CTGACGCAGGTGCGTCTCATAGAGTTGGGCATGCATCAGCAGACGAAAAT
TTTTCAGGGATCCGCTCCAGCGCATCTTTGTCTGCGTCTGAACTACAGTG
TAGACGAGCAAGAGGGCTACTTTCACATGTTTCGCTCGGCCAATCTAAGA
TTCTTTAACAACATGGCCTATGTGATCAAGACGCAGGAGGAGGTAGCCGA
GTCCATGACTTCAATTGTCGAGATGTTCCGCATTGCCCTGGATAATGCAG
GGAATACAGAAGTACGATACATTACGGGTGGGGTGCTGCAGCGAAGAAAG
AGCAAGTTGCCCACTTTGGATGTTCCAAGAGGCATGCCACGCAACCTTTC
CGAATCTCAGCTGGTACAGTTAAGCTCAAAGGCACTTTCAAATATGGCGG
GACAGTTCTCGAAATTGGGACAGACCTTCAAAAAGCCGCAAGCCCATCCC
AGCAGCCTGGCAGCTACTATGAATCCACAAGTAATGCGTCAGAGAGACAG
CGAAATAGAATCTGGCCAGGAAGCGGAAAAGGCAGTTTTCACACTGGGTC
GCAAGCATCGAAATTCCAACAGCGCAAGCAGCACCGATACCGATGAGCAT
GACAACAGTTTGTACGAGCCCGAGGTGGACTCGGATGTGGAGATAGCTAT
GGACAAGTCCAACTACAACGAGAACGCCTTTCTGCCGTCGGTGGGTATTG
TAATGGGTAATCAGAAGGAGGACTCGCCTAGCTCCTCCGATGAAATTCGA
CATTTGGAGCAGAAGGATAGCATGTGCAAAACCACAGAGGATGTGCTAAC
CATTTCCATAACCTCCGTGACGGACCACGTTGGTCTGCCCACGGGCCTTC
TGGAAAATGCACCGGCCATCCGACCGATTACGCCAAATCCGTTGATCTGT
GTGGAAGCTCACGAAGCATTTGATGACAGGGAGGAGGGGGTGAAGCCTGT
GTCCAGTGCCTGCTCCATACCACATACACTCAGGCTGTTTCTGGCCAAAA
ATCGCTCAAAATAAACAGAACTAGTTAAAGCTAAGCCGTGTTTGTACTGT
AACGCGTTTTCAGTACGTCCGCCAGGGATCTCAGCCTTCCCGGTTTGCCC
ACTCACCCGGAAGCCAACAAGCTGAAGCAGCTTACTAGCCCGCTCTCGAA
GCTGGCCAAGAACATTGGCTTGAACTTGGACCCCCGCAAGATAGCCACCA
AGACCGGAGTCCTCTCACCTACCATCCTCTCCGCCGAGAATTCTCCGCCG
GAGCGCGACCCAAGCTCACGGGATCACTTGCTGGAGCTGTGGGAGGCCGA
GAAGTGCAAAACCAAGTTAATAGCCTTGTAAGAAGGTCACTAGGCGGGCA
ATAGCCGAAGCTACACACTTTTTAATAAATAAGTGCAAGTGATATATTTA
TTTTCGAAATAGAATGCAAGAAAACGAAAAAAAAAAAAAAAAAAA

FI05620.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-RA 3536 CG7956-RA 5..3534 1..3530 17650 100 Plus
CG7956-RE 3938 CG7956-RE 2110..3895 1745..3530 8930 100 Plus
CG7956-RB 3970 CG7956-RB 2143..3927 1746..3530 8925 100 Plus
CG7956-RE 3938 CG7956-RE 32..1776 1..1745 8725 100 Plus
CG7956-RB 3970 CG7956-RB 32..1776 1..1745 8725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17349535..17350610 1981..3056 5230 99.1 Plus
chr3R 27901430 chr3R 17346794..17347220 433..859 2060 98.8 Plus
chr3R 27901430 chr3R 17347460..17347826 980..1346 1760 98.6 Plus
chr3R 27901430 chr3R 17347896..17348225 1346..1675 1620 99.4 Plus
chr3R 27901430 chr3R 17350862..17351110 3054..3302 1230 99.6 Plus
chr3R 27901430 chr3R 17349234..17349471 1745..1982 1190 100 Plus
chr3R 27901430 chr3R 17346512..17346744 206..438 1150 99.6 Plus
chr3R 27901430 chr3R 17351175..17351400 3301..3526 1100 99.1 Plus
chr3R 27901430 chr3R 17344677..17344885 1..209 985 98.1 Plus
chr3R 27901430 chr3R 17347276..17347397 859..980 610 100 Plus
chr3R 27901430 chr3R 17348275..17348358 1662..1745 375 96.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-RA 3003 CG7956-PA 1..3003 112..3114 15015 100 Plus
CG7956-RD 3213 CG7956-PD 1..2946 112..3057 14730 100 Plus
CG7956-RG 2964 CG7956-PG 1..2945 112..3056 14725 100 Plus
CG7956-RD 3213 CG7956-PD 2943..3213 3161..3431 1355 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-RA 3543 CG7956-RA 18..3543 1..3526 17630 100 Plus
CG7956-RD 4343 CG7956-RD 18..3074 1..3057 15285 100 Plus
CG7956-RG 3796 CG7956-RG 18..3073 1..3056 15280 100 Plus
CG7956-RD 4343 CG7956-RD 3071..3436 3161..3526 1830 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-PA 1000 CG7956-PA 1..1000 112..3111 5048 100 Plus
CG7956-PD 1070 CG7956-PD 1..982 112..3057 4955 100 Plus
CG7956-PG 987 CG7956-PG 1..981 112..3054 4951 100 Plus
CG7956-PF 1142 CG7956-PF 1..573 112..1830 2789 97.2 Plus
CG7956-PE 662 CG7956-PE 1..573 112..1830 2789 97.2 Plus
CG7956-PF 1142 CG7956-PF 618..1054 1747..3057 2231 100 Plus
CG7956-PD 1070 CG7956-PD 980..1070 3156..3428 454 98.9 Plus
CG7956-PF 1142 CG7956-PF 1052..1142 3156..3428 454 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21525827..21526902 1981..3056 5380 100 Plus
3R 32079331 3R 21523083..21523509 433..859 2120 99.8 Plus
3R 32079331 3R 21523751..21524117 980..1346 1835 100 Plus
3R 32079331 3R 21524187..21524516 1346..1675 1650 100 Plus
3R 32079331 3R 21527153..21527401 3054..3302 1245 100 Plus
3R 32079331 3R 21525526..21525763 1745..1982 1190 100 Plus
3R 32079331 3R 21522801..21523033 206..438 1165 100 Plus
3R 32079331 3R 21527466..21527695 3301..3530 1150 100 Plus
3R 32079331 3R 21520945..21521153 1..209 1045 100 Plus
3R 32079331 3R 21523567..21523688 859..980 610 100 Plus
3R 32079331 3R 21524566..21524649 1662..1745 375 96.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21266658..21267733 1981..3056 5380 100 Plus
3R 31820162 3R 21263914..21264340 433..859 2120 99.7 Plus
3R 31820162 3R 21264582..21264948 980..1346 1835 100 Plus
3R 31820162 3R 21265018..21265347 1346..1675 1650 100 Plus
3R 31820162 3R 21267984..21268232 3054..3302 1245 100 Plus
3R 31820162 3R 21266357..21266594 1745..1982 1190 100 Plus
3R 31820162 3R 21263632..21263864 206..438 1165 100 Plus
3R 31820162 3R 21268297..21268526 3301..3530 1150 100 Plus
3R 31820162 3R 21261776..21261984 1..209 1045 100 Plus
3R 31820162 3R 21264398..21264519 859..980 610 100 Plus
3R 31820162 3R 21265397..21265480 1662..1745 375 96.4 Plus
Blast to na_te.dros performed on 2014-11-27 05:05:39 has no hits.

FI05620.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:56:37 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17351177..17351400 3303..3526 99   Plus
chr3R 17350865..17351110 3057..3302 99 -> Plus
chr3R 17349537..17350610 1983..3056 99 -> Plus
chr3R 17349235..17349471 1746..1982 100 -> Plus
chr3R 17348292..17348358 1679..1745 100 -> Plus
chr3R 17347897..17348228 1347..1678 98 -> Plus
chr3R 17347461..17347826 981..1346 98 -> Plus
chr3R 17347276..17347397 859..980 100 -> Plus
chr3R 17346799..17347219 438..858 99 -> Plus
chr3R 17346515..17346743 209..437 99 -> Plus
chr3R 17344677..17344884 1..208 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:19 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 1..3003 112..3114 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:51 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 1..3003 112..3114 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:02 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 1..3003 112..3114 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:13 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 1..3003 112..3114 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:37 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 1..3003 112..3114 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:04 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 5..3530 1..3526 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:51 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 5..3530 1..3526 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:02 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 18..3543 1..3526 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:13 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 5..3530 1..3526 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:37 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 18..3543 1..3526 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:56:37 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21527468..21527691 3303..3526 100   Plus
3R 21527156..21527401 3057..3302 100 -> Plus
3R 21525829..21526902 1983..3056 100 -> Plus
3R 21525527..21525763 1746..1982 100 -> Plus
3R 21524583..21524649 1679..1745 100 -> Plus
3R 21524188..21524519 1347..1678 99 -> Plus
3R 21523752..21524117 981..1346 100 -> Plus
3R 21523567..21523688 859..980 100 -> Plus
3R 21523088..21523508 438..858 100 -> Plus
3R 21522804..21523032 209..437 100 -> Plus
3R 21520945..21521152 1..208 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:02 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17353190..17353413 3303..3526 100   Plus
arm_3R 17352878..17353123 3057..3302 100 -> Plus
arm_3R 17351551..17352624 1983..3056 100 -> Plus
arm_3R 17351249..17351485 1746..1982 100 -> Plus
arm_3R 17350305..17350371 1679..1745 100 -> Plus
arm_3R 17349910..17350241 1347..1678 99 -> Plus
arm_3R 17349474..17349839 981..1346 100 -> Plus
arm_3R 17349289..17349410 859..980 100 -> Plus
arm_3R 17348810..17349230 438..858 100 -> Plus
arm_3R 17348526..17348754 209..437 100 -> Plus
arm_3R 17346667..17346874 1..208 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:40 Download gff for FI05620.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21268299..21268522 3303..3526 100   Plus
3R 21267987..21268232 3057..3302 100 -> Plus
3R 21266660..21267733 1983..3056 100 -> Plus
3R 21266358..21266594 1746..1982 100 -> Plus
3R 21265414..21265480 1679..1745 100 -> Plus
3R 21265019..21265350 1347..1678 99 -> Plus
3R 21264583..21264948 981..1346 100 -> Plus
3R 21264398..21264519 859..980 100 -> Plus
3R 21263919..21264339 438..858 100 -> Plus
3R 21263635..21263863 209..437 100 -> Plus
3R 21261776..21261983 1..208 100 -> Plus

FI05620.pep Sequence

Translation from 111 to 3113

> FI05620.pep
MEVFQTDSHYIFVKRDKSLWWHRRTSEFSIKAGWDLSSVDDIECIGVTHG
IVGVISLPNVYEPHLVVVKEASAVGVLYPPHLVYKIKSICILSADDPDTD
LPNCTKHTKSNQSTPTHSVSTSNNNNASVPSSGGGSSKSTKLFEGMNKTW
GAVKSAGNTIKNTTQQAANLATKQVKSSVGIREPRHIERRITEELHKIFD
ETDSFYFSFDCDITNNLQRHEAKSEESQSQPDERFFWNKHMIRDLINLND
KTWILPIIQGFMQVENCVIGNECFTLALVSRRSRHRAGTRYKRRGVDEKG
NCANYVETEQILSFRHHQLSFTQVRGSVPIYWSQPGYKYRPPPRLDRGVA
ETQQAFELHFTKELETYGRVCIVNLVEQSGKEKTIGDAYADHVIKLNNDR
LIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWRDQRGMICNQKS
VFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGLSPPYTPIPEQLKSPFM
VLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRYYLAR
FKDSYRQATIDLMLGNQVSSESLSALGGQAGPDENDGTENAEQAKLLVED
CRRLLLGTAQYPVGAWGLIDADPSSGDINETEVDTILLLTDDCYIVAEYD
SHLDKIVRFEKVQLTQVRLIELGMHQQTKIFQGSAPAHLCLRLNYSVDEQ
EGYFHMFRSANLRFFNNMAYVIKTQEEVAESMTSIVEMFRIALDNAGNTE
VRYITGGVLQRRKSKLPTLDVPRGMPRNLSESQLVQLSSKALSNMAGQFS
KLGQTFKKPQAHPSSLAATMNPQVMRQRDSEIESGQEAEKAVFTLGRKHR
NSNSASSTDTDEHDNSLYEPEVDSDVEIAMDKSNYNENAFLPSVGIVMGN
QKEDSPSSSDEIRHLEQKDSMCKTTEDVLTISITSVTDHVGLPTGLLENA
PAIRPITPNPLICVEAHEAFDDREEGVKPVSSACSIPHTLRLFLAKNRSK
*

FI05620.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18605-PA 1002 GF18605-PA 1..997 1..988 4474 84.4 Plus
Dana\GF23080-PA 389 GF23080-PA 70..336 546..812 1262 86.9 Plus
Dana\GF24443-PA 592 GF24443-PA 105..507 184..572 703 37.1 Plus
Dana\GF23495-PA 125 GF23495-PA 44..124 327..411 389 83.5 Plus
Dana\GF21310-PA 858 GF21310-PA 118..560 159..565 389 28.4 Plus
Dana\GF23080-PA 389 GF23080-PA 1..39 1..39 169 76.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24675-PA 1072 GG24675-PA 1..573 1..573 2996 95.3 Plus
Dere\GG24675-PA 1072 GG24675-PA 618..1072 546..1000 2328 96.5 Plus
Dere\GG14768-PA 594 GG14768-PA 106..507 184..572 712 39.2 Plus
Dere\GG25009-PA 858 GG25009-PA 118..560 159..565 403 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17485-PA 1150 GH17485-PA 1..567 1..565 2747 86.4 Plus
Dgri\GH17485-PA 1150 GH17485-PA 616..1068 542..992 1761 75.4 Plus
Dgri\GH15441-PA 592 GH15441-PA 121..507 195..572 712 40.4 Plus
Dgri\GH13130-PA 855 GH13130-PA 118..561 159..565 412 28.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-PA 1000 CG7956-PA 1..1000 1..1000 5223 100 Plus
CG7956-PD 1070 CG7956-PD 1..982 1..982 5130 100 Plus
CG7956-PG 987 CG7956-PG 1..981 1..981 5126 100 Plus
CG7956-PF 1142 CG7956-PF 1..573 1..573 2964 97.2 Plus
CG7956-PE 662 CG7956-PE 1..573 1..573 2964 97.2 Plus
CG7956-PF 1142 CG7956-PF 618..1054 546..982 2231 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22811-PA 1145 GI22811-PA 1..572 1..573 2717 84.8 Plus
Dmoj\GI22811-PA 1145 GI22811-PA 615..1075 544..1000 1841 76.7 Plus
Dmoj\GI13040-PA 588 GI13040-PA 103..513 184..584 747 40.3 Plus
Dmoj\GI22781-PA 856 GI22781-PA 118..561 159..565 409 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23948-PA 1145 GL23948-PA 1..582 1..573 2819 88 Plus
Dper\GL23948-PA 1145 GL23948-PA 627..1073 546..1000 1825 79.7 Plus
Dper\GL14353-PA 858 GL14353-PA 118..560 159..565 394 28.9 Plus
Dper\GL16165-PA 650 GL16165-PA 103..325 184..398 354 37.3 Plus
Dper\GL16165-PA 650 GL16165-PA 435..565 445..572 304 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20719-PC 1073 GA20719-PC 1..1001 1..1000 4629 85.8 Plus
Dpse\GA20719-PB 1202 GA20719-PB 1..582 1..573 2827 88.1 Plus
Dpse\GA20719-PB 1202 GA20719-PB 684..1130 546..1000 1867 80.4 Plus
Dpse\GA21564-PA 588 GA21564-PA 103..503 184..572 715 40 Plus
Dpse\GA19686-PA 1239 GA19686-PA 153..505 212..571 475 33.7 Plus
Dpse\GA14694-PA 858 GA14694-PA 118..560 159..565 394 28.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10430-PA 1072 GM10430-PA 1..573 1..573 3004 96.2 Plus
Dsec\GM10430-PA 1072 GM10430-PA 618..1072 546..1000 2346 96.7 Plus
Dsec\GM14388-PA 621 GM14388-PA 135..536 184..572 714 38.9 Plus
Dsec\GM18479-PA 858 GM18479-PA 118..560 159..565 400 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19432-PA 1000 GD19432-PA 1..1000 1..1000 5369 98.5 Plus
Dsim\GD13597-PA 621 GD13597-PA 135..536 184..572 714 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22815-PA 1150 GJ22815-PA 1..567 1..565 2733 86.6 Plus
Dvir\GJ22815-PA 1150 GJ22815-PA 618..1058 544..983 1802 78.6 Plus
Dvir\GJ12137-PA 588 GJ12137-PA 123..503 201..572 705 40.1 Plus
Dvir\GJ23332-PA 886 GJ23332-PA 118..561 159..565 407 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22749-PA 1147 GK22749-PA 1..565 1..566 2846 89.4 Plus
Dwil\GK22749-PA 1147 GK22749-PA 617..1052 546..974 1917 84.9 Plus
Dwil\GK21146-PA 590 GK21146-PA 118..498 193..565 725 41.8 Plus
Dwil\GK23751-PA 858 GK23751-PA 118..560 159..565 400 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25741-PA 1070 GE25741-PA 1..573 1..573 3049 95.3 Plus
Dyak\GE11227-PA 734 GE11227-PA 1..573 1..573 3025 95.1 Plus
Dyak\GE25741-PA 1070 GE25741-PA 618..1070 546..998 2272 94.9 Plus
Dyak\GE21131-PA 591 GE21131-PA 105..506 184..572 713 38.7 Plus
Dyak\GE11227-PA 734 GE11227-PA 618..696 546..624 423 100 Plus
Dyak\GE18296-PA 858 GE18296-PA 118..560 159..565 402 28.9 Plus

FI05620.hyp Sequence

Translation from 111 to 3113

> FI05620.hyp
MEVFQTDSHYIFVKRDKSLWWHRRTSEFSIKAGWDLSSVDDIECIGVTHG
IVGVISLPNVYEPHLVVVKEASAVGVLYPPHLVYKIKSICILSADDPDTD
LPNCTKHTKSNQSTPTHSVSTSNNNNASVPSSGGGSSKSTKLFEGMNKTW
GAVKSAGNTIKNTTQQAANLATKQVKSSVGIREPRHIERRITEELHKIFD
ETDSFYFSFDCDITNNLQRHEAKSEESQSQPDERFFWNKHMIRDLINLND
KTWILPIIQGFMQVENCVIGNECFTLALVSRRSRHRAGTRYKRRGVDEKG
NCANYVETEQILSFRHHQLSFTQVRGSVPIYWSQPGYKYRPPPRLDRGVA
ETQQAFELHFTKELETYGRVCIVNLVEQSGKEKTIGDAYADHVIKLNNDR
LIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWRDQRGMICNQKS
VFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGLSPPYTPIPEQLKSPFM
VLWANNGDIISRQYAGTNALKANYTRTGERKISGMMKDGMNSANRYYLAR
FKDSYRQATIDLMLGNQVSSESLSALGGQAGPDENDGTENAEQAKLLVED
CRRLLLGTAQYPVGAWGLIDADPSSGDINETEVDTILLLTDDCYIVAEYD
SHLDKIVRFEKVQLTQVRLIELGMHQQTKIFQGSAPAHLCLRLNYSVDEQ
EGYFHMFRSANLRFFNNMAYVIKTQEEVAESMTSIVEMFRIALDNAGNTE
VRYITGGVLQRRKSKLPTLDVPRGMPRNLSESQLVQLSSKALSNMAGQFS
KLGQTFKKPQAHPSSLAATMNPQVMRQRDSEIESGQEAEKAVFTLGRKHR
NSNSASSTDTDEHDNSLYEPEVDSDVEIAMDKSNYNENAFLPSVGIVMGN
QKEDSPSSSDEIRHLEQKDSMCKTTEDVLTISITSVTDHVGLPTGLLENA
PAIRPITPNPLICVEAHEAFDDREEGVKPVSSACSIPHTLRLFLAKNRSK
*

FI05620.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-PA 1000 CG7956-PA 1..1000 1..1000 5212 99.8 Plus
CG7956-PD 1070 CG7956-PD 1..982 1..982 5119 99.8 Plus
CG7956-PG 987 CG7956-PG 1..981 1..981 5115 99.8 Plus
CG7956-PF 1142 CG7956-PF 1..573 1..573 2953 96.9 Plus
CG7956-PE 662 CG7956-PE 1..573 1..573 2953 96.9 Plus
CG7956-PF 1142 CG7956-PF 618..1054 546..982 2231 100 Plus