Clone FI05715 Report

Search the DGRC for FI05715

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:57
Well:15
Vector:pOT2
Associated Gene/TranscriptEno-RB
Protein status:FI05715.pep: gold
Sequenced Size:2194

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Eno 2008-08-15 Release 5.9 accounting
Eno 2008-12-18 5.12 accounting

Clone Sequence Records

FI05715.complete Sequence

2194 bp assembled on 2008-08-14

GenBank Submission: BT058002.1

> FI05715.complete
CCAACACACTGCCTTTGCGCCAACATTCACATCAAAATTCAACCCAATCA
GTTTGGCTAACCATTTCTTTTTATATAAAAATAGACATGCAATCCACAGC
TACGTGTGGATCCCGATTACTCTAACCTTGTGCGAAGGTCAATTTTCCCC
AAAAAATATAGGAAACGTACCAGGGAAAACAACAAAAAAGGGAAAGCGCA
CCCCCACACTGAAAACCGGCGAGCACCTGGAAACGCATACATATAAAAGG
AGAGTAAATATACAAATTGGTAGCACTTTCGCCGCCGTCTTTTACACATT
CAAGCCATGTCTTGGACCGCTTCAGTTTTCTTGAGGACTTCCACCACTAG
CATGAAGTTTCTGCGTCTGCGCTGGCCTCTCCCCAGAATTCCCCAGAATA
AATCGGCAAACGTTGCGCCGCGTTTCAGAAGCAAATCAGCAGTCAGCCAG
CTCTCATCTGGATTTAAATTTGTGCAGATCCGCAAAAGTACTTGTGACAG
CAACGAGATGACCATCAAAGCGATCAAGGCCCGTCAGATCTACGACTCCC
GTGGCAACCCCACCGTGGAGGTCGACCTGACCACCGAGCTGGGACTCTTC
CGCGCCGCCGTGCCCTCCGGCGCCTCCACTGGCGTCCACGAGGCCCTGGA
GCTGCGCGACAACGACAAGGCCAACTACCATGGCAAGTCGGTGCTGAAGG
CCGTGGGCCATGTGAACGACACCCTGGGCCCCGAGCTGATCAAGGCCAAT
CTGGATGTGGTTGACCAGGCGTCCATTGACAACTTCATGATCAAGTTGGA
CGGCACCGAGAACAAGAGCAAGTTCGGAGCCAACGCCATCCTGGGCGTTT
CCCTGGCCGTGGCCAAGGCTGGAGCCGCCAAGAAGGGCGTGCCGCTGTAC
AAACACATTGCCGATCTGGCTGGCAACAAGGAGATCATCCTGCCGGTGCC
CGCTTTCAACGTGATCAACGGCGGCAGCCACGCCGGCAACAAGCTGGCCA
TGCAGGAGTTCATGATCCTGCCCACCGGCGCCACCAGCTTCACAGAGGCC
ATGAAGATGGGCTCCGAGGTGTACCACCACCTGAAGAATGTGATCAAGGC
CAAGTTCGGTCTGGACGCCACCGCCGTGGGCGATGAGGGCGGCTTCGCCC
CCAACATCCAGTCCAACAAGGAGGCTCTGAATCTGATCAGCGATGCCATC
GCCAAGGCCGGATACACCGGCAAGATCGAGATCGGCATGGATGTGGCCGC
CTCCGAGTTCTACAAGGATGGCCAGTACGATCTGGACTTCAAGAACGAGA
AGAGCGACAAGTCGCAGTGGCTGCCCGCCGACAAGCTGGCCAACCTGTAC
CAGGAGTTTATCAAGGACTTCCCCATCGTCTCGATTGAGGATCCCTTTGA
CCAGGACCACTGGGAGGCCTGGTCCAACCTGACCGGCTGCACCGACATCC
AGATCGTGGGCGATGATCTGACCGTGACCAACCCCAAGCGTATTGCCACC
GCCGTGGAGAAGAAGGCCTGCAACTGCCTGCTCCTGAAGGTCAACCAGAT
CGGCACCGTCACCGAATCCATTGCCGCCCATCTGCTGGCCAAGAAGAACG
GCTGGGGCACCATGGTCTCCCACCGTTCCGGTGAGACCGAGGACTCGTTC
ATCGGTGACCTGGTCGTCGGTCTGTCCACCGGCCAGATCAAGACCGGAGC
TCCATGCCGCTCGGAGCGTCTGGCCAAGTACAACCAGATCCTGCGCATCG
AGGAGGAGATCGGCGCTGGCGTCAAGTTCGCCGGCAAGTCGTTCAGGAAG
CCGCAGTAAGCGCAGGGCACTTCGAAATTCCAACCACACCAGCCCCATCG
AATGAGATCTGGATCTTGGAGAGGGAGCTGGACGCAGTAGATCCATGGAA
AGGCGGCGGTGCACGTGTTCGTCAACCTTTTACGTTCGGAACTTGTGTCT
GGCGCACAAATACATCAGAATTAAACTACCAAACCCATTTGCTGTCTCTA
TGCTTCGTTCTTAGACATTATTAATTAATGCTAAACCTTGATCTAATCAT
TATTTATAAACAAAAGCATAAAAAACACTATGTGCAAGATATTCGTTCAG
TTGCCGAGAGCTTTGAATATCTTCAATGTAATCGCTGTAATCGTTTTGAA
ATTATAAATTGATCTACACAAACACCAAAAAAAAAAAAAAAAAA

FI05715.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-RB 2373 Eno-RB 1..2179 1..2179 10730 99.4 Plus
Eno-RD 2374 Eno-RD 80..2180 79..2179 10355 99.5 Plus
Eno-RE 2597 Eno-RE 305..2403 81..2179 10345 99.5 Plus
Eno-RE 2597 Eno-RE 1..29 52..80 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1724792..1726474 2176..494 8295 99.5 Minus
chr2L 23010047 chr2L 1727464..1727698 494..260 1175 100 Minus
chr2L 23010047 chr2L 1727872..1728050 259..81 880 99.4 Minus
chr2L 23010047 chr2L 1729368..1729447 80..1 385 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-RD 1503 CG17654-PD 1..1503 307..1809 7395 99.5 Plus
Eno-RC 1503 CG17654-PC 1..1503 307..1809 7395 99.5 Plus
Eno-RE 1503 CG17654-PE 1..1503 307..1809 7395 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-RB 2183 CG17654-RB 8..2183 1..2176 10715 99.5 Plus
Eno-RD 2198 CG17654-RD 101..2198 79..2176 10340 99.5 Plus
Eno-RC 2257 CG17654-RC 162..2257 81..2176 10330 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-PD 500 CG17654-PD 1..500 307..1806 2457 100 Plus
Eno-PC 500 CG17654-PC 1..500 307..1806 2457 100 Plus
Eno-PE 500 CG17654-PE 1..500 307..1806 2457 100 Plus
Eno-PB 500 CG17654-PB 1..500 307..1806 2457 100 Plus
Eno-PF 433 CG17654-PF 1..433 508..1806 2115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1724971..1726656 2179..494 8280 99.4 Minus
2L 23513712 2L 1727646..1727880 494..260 1175 100 Minus
2L 23513712 2L 1728054..1728232 259..81 895 100 Minus
2L 23513712 2L 1729550..1729629 80..1 385 98.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1724971..1726656 2179..494 8280 99.4 Minus
2L 23513712 2L 1727646..1727880 494..260 1175 100 Minus
2L 23513712 2L 1728054..1728232 259..81 895 100 Minus
2L 23513712 2L 1729550..1729629 80..1 385 98.7 Minus
Blast to na_custom.ecoli performed 2008-08-14 11:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Escherichia 10385 Escherichia 8169..8252 857..774 165 79.7 Minus
Escherichia 13234 Escherichia 5457..5540 857..774 165 79.7 Minus
E.coli 2089 E.coli 291..374 774..857 150 78.5 Plus
Blast to na_te.dros performed 2014-11-27 07:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2332..2399 2075..2009 130 67.6 Minus

FI05715.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:39:55 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1729368..1729447 1..80 98   Minus
chr2L 1727872..1728050 81..259 99 <- Minus
chr2L 1727464..1727698 260..494 100 <- Minus
chr2L 1724792..1726473 495..2176 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:25 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RC 1..1503 307..1809 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:43 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RC 1..1503 307..1809 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:34 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RE 1..1503 307..1809 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:58 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 1..1503 307..1809 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:39:55 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RE 1..1503 307..1809 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:35:09 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 1..2176 1..2176 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:43 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 1..2176 1..2176 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:34 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 8..2183 1..2176 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:12 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 1..2176 1..2176 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:39:55 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
Eno-RB 8..2183 1..2176 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:39:55 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729550..1729629 1..80 98   Minus
2L 1728054..1728232 81..259 100 <- Minus
2L 1727646..1727880 260..494 100 <- Minus
2L 1724974..1726655 495..2176 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:34 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1729550..1729629 1..80 98   Minus
arm_2L 1728054..1728232 81..259 100 <- Minus
arm_2L 1727646..1727880 260..494 100 <- Minus
arm_2L 1724974..1726655 495..2176 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:19 Download gff for FI05715.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729550..1729629 1..80 98   Minus
2L 1728054..1728232 81..259 100 <- Minus
2L 1727646..1727880 260..494 100 <- Minus
2L 1724974..1726655 495..2176 99 <- Minus

FI05715.pep Sequence

Translation from 306 to 1808

> FI05715.pep
MSWTASVFLRTSTTSMKFLRLRWPLPRIPQNKSANVAPRFRSKSAVSQLS
SGFKFVQIRKSTCDSNEMTIKAIKARQIYDSRGNPTVEVDLTTELGLFRA
AVPSGASTGVHEALELRDNDKANYHGKSVLKAVGHVNDTLGPELIKANLD
VVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLYKH
IADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILPTGATSFTEAMK
MGSEVYHHLKNVIKAKFGLDATAVGDEGGFAPNIQSNKEALNLISDAIAK
AGYTGKIEIGMDVAASEFYKDGQYDLDFKNEKSDKSQWLPADKLANLYQE
FIKDFPIVSIEDPFDQDHWEAWSNLTGCTDIQIVGDDLTVTNPKRIATAV
EKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHRSGETEDSFIG
DLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKPQ
*

FI05715.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15876-PA 499 GF15876-PA 37..499 41..500 2219 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24579-PA 511 GG24579-PA 1..511 1..500 2454 93.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25025-PA 433 GH25025-PA 1..433 68..500 2121 94.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-PD 500 CG17654-PD 1..500 1..500 2564 100 Plus
Eno-PC 500 CG17654-PC 1..500 1..500 2564 100 Plus
Eno-PE 500 CG17654-PE 1..500 1..500 2564 100 Plus
Eno-PB 500 CG17654-PB 1..500 1..500 2564 100 Plus
Eno-PF 433 CG17654-PF 1..433 68..500 2222 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13781-PA 433 GI13781-PA 1..433 68..500 2111 93.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18473-PA 296 GL18473-PA 35..296 238..500 1132 82.6 Plus
Dper\GL18473-PA 296 GL18473-PA 1..51 68..118 255 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Eno-PA 501 GA14598-PA 43..501 39..500 2153 90.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16597-PA 500 GM16597-PA 1..500 1..500 2645 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22899-PA 517 GD22899-PA 1..490 1..490 2576 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17449-PA 510 GJ17449-PA 44..510 40..500 2179 90.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18469-PA 433 GK18469-PA 1..433 68..500 2140 95.2 Plus
Dwil\GK20200-PA 462 GK20200-PA 1..393 68..460 1937 94.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15467-PA 504 GE15467-PA 1..504 1..500 2425 93.3 Plus

FI05715.hyp Sequence

Translation from 306 to 1808

> FI05715.hyp
MSWTASVFLRTSTTSMKFLRLRWPLPRIPQNKSANVAPRFRSKSAVSQLS
SGFKFVQIRKSTCDSNEMTIKAIKARQIYDSRGNPTVEVDLTTELGLFRA
AVPSGASTGVHEALELRDNDKANYHGKSVLKAVGHVNDTLGPELIKANLD
VVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLYKH
IADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILPTGATSFTEAMK
MGSEVYHHLKNVIKAKFGLDATAVGDEGGFAPNIQSNKEALNLISDAIAK
AGYTGKIEIGMDVAASEFYKDGQYDLDFKNEKSDKSQWLPADKLANLYQE
FIKDFPIVSIEDPFDQDHWEAWSNLTGCTDIQIVGDDLTVTNPKRIATAV
EKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHRSGETEDSFIG
DLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKPQ
*

FI05715.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Eno-PD 500 CG17654-PD 1..500 1..500 2564 100 Plus
Eno-PC 500 CG17654-PC 1..500 1..500 2564 100 Plus
Eno-PE 500 CG17654-PE 1..500 1..500 2564 100 Plus
Eno-PB 500 CG17654-PB 1..500 1..500 2564 100 Plus
Eno-PF 433 CG17654-PF 1..433 68..500 2222 100 Plus