Clone FI05801 Report

Search the DGRC for FI05801

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:58
Well:1
Vector:pOT2
Associated Gene/Transcriptbe-RC
Protein status:FI05801.pep: gold
Sequenced Size:5101

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32594 2008-08-15 Release 5.9 accounting
CG5541 2008-08-15 Release 5.9 accounting
CG32594 2008-12-18 5.12 accounting
CG5541 2008-12-18 5.12 accounting
CG32594 2011-03-01 Transcript Validation

Clone Sequence Records

FI05801.complete Sequence

5101 bp assembled on 2008-07-17

GenBank Submission: BT044236.1

> FI05801.complete
CATCCGGTAAACACGTCTCACAACGTTATTTGTGTTGAATATATATATAT
TTTTTTGTTGTGGCTCTTTTTTTTTTAATTTCTGCGGCCCCTAAAGTTCG
ACGATCGTGAGAAGGGAAAAAGAGTGTGAAGTGACCTAAGCGGTTTTGAA
AATATCTATCTTGGCAAAACGAAAACAAATTTGTTAAAGCACATATAAAC
AAAAACAAAATAACAAAAATAAAAGTGAAGCAAAGGTGAAGAAGACCAGA
ATGAATTCGCGACGGATTGCTCTGGTCCTCCTAATCGGCATAATCGTTTC
GTTTTCTGGCCATGATGCACTAACCTATCCGGAGCGCTTCGATCGCCTGC
CCACTTGGGGTGGTCATTCCCAAATTGGTGGGCCGCTGCTGGATACCGCC
CACCGGGAGAATCGTGAGAAAAGGGAGAATAGGGTGGACCTGTGCCGGCA
CTGTTTCTGCATTCATCTCAAGGCAATCTGTGATTACAAGCTTAACAAAA
CGCTCCCGAACGAATTTAACGATAAACTATTGGTGCCGCTGAACATCAAA
TATATTGAGGTGCGACTGACTGTTGGCACCCAGTTCGTGATGTACGAGAA
CTTCTTCCAGGACAACCAGGTGAACTACTTTGGTGTAATCGGAGTGGGGA
AAGATGACCAGGTGGAAATAACCAGCAATGCATTTAGCCACAACAAAGGC
GGTTTTCCCAACATCGAAATACGAAATGTATTGCGAGTTTTTCTGCGTGA
GAAATTCCTGACCGGTGCGGACTACAAGCTGCTGGTGGAGGATGTTACTC
AGCTGTCCGTATTCTCCAATGCCCTTCAGATGACTAATCTAGACTGTTCT
CTCAAGCGGATCAAGGAGCTGAATCTGATGAAGAACGCTTTCAATCCTGG
GGTTGCCAAATATGGAATAAATCTCCGCATCGAGGATTCGAACATCAATC
AGCTGGGTATATTCGGCGTGTCCATGGGCAAGGTGAGCCTGTTGCGCTGC
CACATCGACATGATCATGAGCAACGCCTTTGACGTTACCAGCATCAAGGA
GCTGATTATCGAGGGCTGCAATATCGAGGTGATCGAGAGCCAGGCGCTAA
CCAACAAATTGCATAGCGATAAGGTGGCCATCGTGGATACGGTGATCGGT
ACGATTGAGGGTCAGGCGATCAGTCAGAGCGGTATAACTACCATGATTAT
GTTTGGAAATACAATTACAAAAATACGTTCGAATGCCATTCAAATTGTTG
CCGTTAGTCTGTTCATACGCAACAATTCAATGAGCCATGTGGAGCCCAAT
TGGTTGAGTGTCAGCCAGGCCGATCAAGTGGAGATTGCGAATAATCGCTT
CGAGGACTACGGACGCTGTGAACTGAACATTGGCTCCTCGAACTGCAGTT
TTCGCAACAATATACTGCAGAATCCGCAATCGGGTAGCCTCAATTTTACA
TGTCGCGTCCACCAGGTGCGCGTGGGCACCGAGTGCTCGTGCAACAAGTC
CTGGCTATCGGAGCTAACCGATCATGATCTGGAATCGGAAATCATGTGTC
AGGTGGCAAAGCGTGATGCCAACTGCTTTAATGCCACCAATACGGATGTC
CGCCGGTATGTCAACGAGGCATGTGGCAGCAATGTGACCCGCTACTGTAT
GGGTGGCCAGTGGGTGACCAAGGCGGTCAGTGATCATTCTAGCGACTCCA
GCAAATTGACCATCGGAATGATAGCCCTTGAGATTGTGATTTTAACACTC
TTGCTTGTTGCGATTGTCTGTGTGTTGGCCAAAAACTGTGGCAGTGGAAG
CTGCGCTCCTGCCGGTGGCCAGTCCACTGATAATTGCCTAATCGAGGAGG
ACATTCGCAACTCACTGCGCCAGCTCGCACTGCACAGCGAGAGCAATAAG
ACACGCAAGGCTATACTGAAGCTGATCAATGGTCATTTGAGCAAGGGGGA
GTGCAACGATCGGATACTCTTTATAGTGGACAACATGCCGCAAAATCAGG
CGATCGAAAGCCTGCTGTTTAGGCACATATCGCAGAGTCACATGGAGCCC
AGTGATAGTGAGGCATATGCCAGCACCGCCTTAACAGCCAATGCAACAGC
ACCACCACTGCCGCCCAGTACCGATTCCAGTGAGCCCATCTACCAAGAGC
TCGACCAGCAACGACTGATCATCGACGACAAGTACTCATTGCCGCTGAAT
TCCGACGAGGATCCGCCGTACTCGGAGCCGTCCAATATGATGAATACGAA
CGACATGCCACCGGCATATCAATATGCCACACCGATGCGCATCCTGCCAT
GCCACCAGATGCAGCATCAGCAGCCGTCGACGACGGCCAATTATGCCATC
CCCGTTTGGAGGTCCACTCCAAGTGCCACGCCCACTAGCCGCCCACCCTC
GGGCTCACAGGAGGGGTCGGCCACCGCCACAGCGCCCAGAGCTGTCAAGG
ATTTGCGGCAGGCTCTGCAGAACTCCCCACAGTTCCATCCCAACCAGCTG
ACCTCAACGCGCAACCAAAGACAAATCCTGCAGATTCTGCCGCCGCTTCA
GCCGCCGCCGTACACTCAGAGGTCACAGGTCAGGGGTCAGCGGAGGCGCA
GCTTCGAGTGCCTCGATGGCGCCGCCAGCTTGGCGGCCATGGAGCACATG
GACTCCGGCTCGGATCACTCTGGCGGCAGTGATGTGACCGTCCAAATTGC
TGATGTGATCGACTACGCGGATGCCTAAAAATAAGAAACACCTTGAAAGA
TAAGGCTGGAGCGAAACGGTCTATAATCGGCAGTTCTACGGAACGCTCAC
GGCGAAGAGCAGTGCACAGCGGAGCGGACGGTAAACACAACTAGAAAATG
AACAAAGAGTGGACCGGAGAATAGAGAAGGCGAAACGAGCGAGGGCGCGC
AAAAGGCACCAGTTAATATGAGTGAATAATTGGCCACAGGCGGATCAGTT
GACCAATCATGCGGAATATCAGAAATCTCAAGGATCCGACGACATGGACG
CGGATTCTCCTGCCGTTCCTCTCCTGCCTACTCCTCGCTGTCCAGGCGGA
TCTGGTGAATGTCACCTGCGGGGAGTATGGCAATACCATCACTTGCGACT
GCAATAACTCCGACCAGACCATGGCTTTGCCATCGTTGCGCGGAAATGTC
TACATGATTGAGATCCGCAATTGCCGCGATCTTCTGGTGGAGGCCAATCG
GCTGGCGAACACGATGGGCCTGCACAAGGTGGTCTTCCGCCAGGTGGGCC
AACTGGTGCTCCGGGAGCACGCGCTCAGTGTGCCGCGATATGCCAGCAAT
AAGGCACTGATCGTGGAGTTCGAGCAGACGAACCTCAAGCTGATCGAATC
GCATGCCATCAACGGCAACATCGAGGAGATCTCATTCGTGGGCGGGCGGA
TTGAGCTAATGAAGCCTTTCGGATTCACCACCACCAAGGATAGTGCCATA
CTGCTCAAGCTGGACGGGGTCACCATTCAGCGCATCGAGAGTCAAGCCTT
TAAGAAATTCGCCGTGGAGCAGATGAGCATCGCCAATTGCCAATTCCTGG
GCGATCTGCCCACGCGTGCCTTCTACGAGCTCGAGGTGACCAACGAGCTG
AGTCTGCGAGGTAATCAGTTCCAGGAGGTCCACTCCCATGCCTTCTCCTT
CAAGCTTGTCTCCAAGTTAAGCCTGAGTGATAATCATTTCCTATCCGTCG
ATGGTGAGTGGTTGGAAGCCCAAATCAGAGATGCGGCGACAATACGAGGA
AACGAATTCGGGGCCACAAGTGAGATTGCGTTTCGCAGCCTCACCGTTCA
TCGTTCGTATCAGTTGAGCGAGCGTCTGGAGCTGCGTTTCCACAACAACA
GTCTGCGCAGCTCGCGACCAGGTGCAGATCCTCGGGTCGATGGCACCGCC
GAGAATGTGGCACCACAACCCCTTCAATTCGACAATAGCTTCGCGCTCAA
TGTACGCGATATCCGCTATAATAATGCCTGGAGCTGTGAACAGCTGGACA
GGAATGTGGAGCCACCATTGCCGCGAGCGGAGTTCTTCCGACTGCACAGC
GATCAACTGATGTTCCATCCGCCCGATTTTGGCGGACAAGGCCAAATCCA
GCCGTATATCCCACTTCGATCCCTGATCACGGATGAGTGCCGCGAGCGCA
GCTACATGGCCTTTATTATCTCGGGTAGTGTTCTTCTGGGACTACTGCTG
CTCCTCCTGATCCTTTTGCTGTGGTGGCGAGTAGTCCAAAAGCGACGACG
TCGTAAGCTGGACGTAGTGCAGCCGGAACCGCGCACTTACAAGGAAACCC
AGATCGTATACCAAATCGAGAACGCTGGCCTGCTAAAGACTGATTTGTAG
ACGGCAAGGAAAGACACATAGATCACAGATGCCTGTTTTGGACTGTTTTT
CAGTACCATAGCAGATCATCTACCCACAAGAGACACACAGCTGAATGAAG
CTAAAAGGAGCGGTGGGCGGTGGAATGGTTGGAGCACCATTGCCACCATT
ACCACCACCGATCATACAGAACCACCAATGCGTGACCTTTCGCTGTACCA
AAACCATAGCCTACAGTTAGTCGTAATATATCTTAATCTAATTATTCATA
ACTCGCAATGTTCGTCAGTTGTAAGTGGCCCATGTATATAGTCGCATGTA
GGCTGGGATCTTGCCCAAAAATATCCAGGTGGATTAGCCATATCCCACCA
AATACGTATGTATATGGAATAAATCAATTTAAAGCCAAAATGTGGTGCTC
TTAAATGTATATGCTACATATGTACATATATGTTAATACTATTTGGAAGC
GTAATTTAAAATAACAAAATTTGGAGGACAAAGTCAGCTAATAAAATATT
GTATACAAATTGCGGATGACAGACGAGATGTACGTGTAAACAAAAGTTTT
ATTGATCCCTATAGCTTTCGAAAATATTTTTAGAAACTTGACACATGTTT
ACAAGATAATCATAAACTTTCAAAGGGAAATAGTGTTGGAAGGAAGCCCA
TTTTTGTTTACGATATTTAAATATTTATAAATAATATTATATTTCCCATT
TCCCAAATACATTACGATTTAAATAATGATAGTAAAAAAAAAAAAAAAAA
A

FI05801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32594-RC 3242 CG32594-RC 22..2749 1..2730 13570 99.9 Plus
CG5541-RA 2543 CG5541-RA 220..2543 2731..5054 11620 100 Plus
CG32594-RB 4103 CG32594-RB 109..2349 1..2243 11135 99.9 Plus
CG32594-RB 4103 CG32594-RB 3124..3610 2244..2730 2435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14940569..14941996 3656..5083 7140 100 Plus
chrX 22417052 chrX 14921701..14922731 1213..2243 5140 99.9 Plus
chrX 22417052 chrX 14914597..14915097 1..502 2460 99.8 Plus
chrX 22417052 chrX 14923764..14924250 2244..2730 2435 100 Plus
chrX 22417052 chrX 14939033..14939419 2731..3117 1935 100 Plus
chrX 22417052 chrX 14939912..14940293 3115..3496 1910 100 Plus
chrX 22417052 chrX 14921336..14921625 923..1212 1450 100 Plus
chrX 22417052 chrX 14920743..14921007 502..766 1325 100 Plus
chrX 22417052 chrX 14940354..14940513 3496..3655 800 100 Plus
chrX 22417052 chrX 14921068..14921226 764..922 795 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
be-RF 2478 CG32594-PF 1..2478 251..2728 12390 100 Plus
be-RC 2478 CG32594-PC 1..2478 251..2728 12390 100 Plus
be-RB 2103 CG32594-PB 1..1993 251..2243 9965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
be-RF 3069 CG32594-RF 20..2747 1..2730 13550 99.9 Plus
be-RC 3240 CG32594-RC 20..2747 1..2730 13550 99.9 Plus
CG5541-RA 2514 CG5541-RA 162..2514 2731..5083 11765 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
be-PF 825 CG32594-PF 1..825 251..2725 3764 100 Plus
be-PC 825 CG32594-PC 1..825 251..2725 3764 100 Plus
be-PB 700 CG32594-PB 1..665 251..2245 3226 99.8 Plus
CG5541-PB 463 CG5541-PB 1..463 2959..4347 2141 100 Plus
CG5541-PA 463 CG5541-PA 1..463 2959..4347 2141 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15050415..15051843 3656..5084 7145 100 Plus
X 23542271 X 15031543..15032573 1213..2243 5155 100 Plus
X 23542271 X 15033606..15034092 2244..2730 2435 100 Plus
X 23542271 X 15024455..15024954 1..502 2410 99.6 Plus
X 23542271 X 15048879..15049265 2731..3117 1935 100 Plus
X 23542271 X 15049758..15050139 3115..3496 1910 100 Plus
X 23542271 X 15031178..15031467 923..1212 1450 100 Plus
X 23542271 X 15030585..15030849 502..766 1325 100 Plus
X 23542271 X 15050200..15050359 3496..3655 800 100 Plus
X 23542271 X 15030910..15031068 764..922 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15058513..15059941 3656..5084 7145 100 Plus
X 23527363 X 15039641..15040671 1213..2243 5155 100 Plus
X 23527363 X 15041704..15042190 2244..2730 2435 100 Plus
X 23527363 X 15032553..15033052 1..502 2430 99.6 Plus
X 23527363 X 15056977..15057363 2731..3117 1935 100 Plus
X 23527363 X 15057856..15058237 3115..3496 1910 100 Plus
X 23527363 X 15039276..15039565 923..1212 1450 100 Plus
X 23527363 X 15038683..15038947 502..766 1325 100 Plus
X 23527363 X 15058298..15058457 3496..3655 800 100 Plus
X 23527363 X 15039008..15039166 764..922 795 100 Plus
Blast to na_te.dros performed 2014-11-27 15:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 2460..2595 4910..5040 120 55.9 Plus

FI05801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14940569..14941996 3656..5083 97   Plus
chrX 14940354..14940513 3496..3655 100 -> Plus
chrX 14939915..14940292 3118..3495 100 -> Plus
chrX 14939033..14939419 2731..3117 100 -> Plus
chrX 14923764..14924250 2244..2730 100 -> Plus
chrX 14921701..14922731 1213..2243 99 -> Plus
chrX 14921336..14921625 923..1212 100 -> Plus
chrX 14921069..14921226 765..922 100 -> Plus
chrX 14920744..14921005 503..764 100 -> Plus
chrX 14914597..14915097 1..502 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:15 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32594-RC 1..2478 251..2728 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:08 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 1..2478 251..2728 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:11 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 1..2478 251..2728 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32594-RC 1..2478 251..2728 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 1..2478 251..2728 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:14 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32594-RC 22..2762 1..2741 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:08 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 22..2762 1..2741 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:11 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 20..2760 1..2741 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32594-RC 22..2762 1..2741 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 20..2760 1..2741 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:33 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
X 15050415..15051842 3656..5083 100   Plus
X 15050200..15050359 3496..3655 100 -> Plus
X 15049761..15050138 3118..3495 100 -> Plus
X 15048879..15049265 2731..3117 100 -> Plus
X 15033606..15034092 2244..2730 100 -> Plus
X 15031543..15032573 1213..2243 100 -> Plus
X 15031178..15031467 923..1212 100 -> Plus
X 15030911..15031068 765..922 100 -> Plus
X 15030586..15030847 503..764 100 -> Plus
X 15024455..15024954 1..502 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:11 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14944448..14945875 3656..5083 100   Plus
arm_X 14944233..14944392 3496..3655 100 -> Plus
arm_X 14943794..14944171 3118..3495 100 -> Plus
arm_X 14942912..14943298 2731..3117 100 -> Plus
arm_X 14927639..14928125 2244..2730 100 -> Plus
arm_X 14925576..14926606 1213..2243 100 -> Plus
arm_X 14925211..14925500 923..1212 100 -> Plus
arm_X 14924944..14925101 765..922 100 -> Plus
arm_X 14924619..14924880 503..764 100 -> Plus
arm_X 14918488..14918987 1..502 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:02 Download gff for FI05801.complete
Subject Subject Range Query Range Percent Splice Strand
X 15058513..15059940 3656..5083 100   Plus
X 15058298..15058457 3496..3655 100 -> Plus
X 15057859..15058236 3118..3495 100 -> Plus
X 15056977..15057363 2731..3117 100 -> Plus
X 15041704..15042190 2244..2730 100 -> Plus
X 15039641..15040671 1213..2243 100 -> Plus
X 15039276..15039565 923..1212 100 -> Plus
X 15039009..15039166 765..922 100 -> Plus
X 15038684..15038945 503..764 100 -> Plus
X 15032553..15033052 1..502 99 -> Plus

FI05801.pep Sequence

Translation from 250 to 2727

> FI05801.pep
MNSRRIALVLLIGIIVSFSGHDALTYPERFDRLPTWGGHSQIGGPLLDTA
HRENREKRENRVDLCRHCFCIHLKAICDYKLNKTLPNEFNDKLLVPLNIK
YIEVRLTVGTQFVMYENFFQDNQVNYFGVIGVGKDDQVEITSNAFSHNKG
GFPNIEIRNVLRVFLREKFLTGADYKLLVEDVTQLSVFSNALQMTNLDCS
LKRIKELNLMKNAFNPGVAKYGINLRIEDSNINQLGIFGVSMGKVSLLRC
HIDMIMSNAFDVTSIKELIIEGCNIEVIESQALTNKLHSDKVAIVDTVIG
TIEGQAISQSGITTMIMFGNTITKIRSNAIQIVAVSLFIRNNSMSHVEPN
WLSVSQADQVEIANNRFEDYGRCELNIGSSNCSFRNNILQNPQSGSLNFT
CRVHQVRVGTECSCNKSWLSELTDHDLESEIMCQVAKRDANCFNATNTDV
RRYVNEACGSNVTRYCMGGQWVTKAVSDHSSDSSKLTIGMIALEIVILTL
LLVAIVCVLAKNCGSGSCAPAGGQSTDNCLIEEDIRNSLRQLALHSESNK
TRKAILKLINGHLSKGECNDRILFIVDNMPQNQAIESLLFRHISQSHMEP
SDSEAYASTALTANATAPPLPPSTDSSEPIYQELDQQRLIIDDKYSLPLN
SDEDPPYSEPSNMMNTNDMPPAYQYATPMRILPCHQMQHQQPSTTANYAI
PVWRSTPSATPTSRPPSGSQEGSATATAPRAVKDLRQALQNSPQFHPNQL
TSTRNQRQILQILPPLQPPPYTQRSQVRGQRRRSFECLDGAASLAAMEHM
DSGSDHSGGSDVTVQIADVIDYADA*

FI05801.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22074-PA 780 GF22074-PA 11..780 89..825 1413 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17856-PA 844 GG17856-PA 1..844 1..825 3389 78.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12762-PA 802 GH12762-PA 17..800 89..825 1116 35.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
be-PF 825 CG32594-PF 1..825 1..825 4290 100 Plus
be-PC 825 CG32594-PC 1..825 1..825 4290 100 Plus
be-PB 700 CG32594-PB 1..665 1..665 3441 99.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15207-PA 691 GI15207-PA 6..691 131..825 737 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26780-PA 931 GL26780-PA 1..718 102..768 1225 40.5 Plus
Dper\GL10069-PA 227 GL10069-PA 39..227 667..825 401 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23053-PA 890 GA23053-PA 60..890 63..825 1474 41.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12051-PA 829 GM12051-PA 1..829 1..825 3635 85.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17185-PA 602 GD17185-PA 1..599 1..600 2876 90.7 Plus
Dsim\GD13967-PA 135 GD13967-PA 1..135 687..825 631 88.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16617-PA 834 GJ16617-PA 55..834 64..825 1074 35.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20121-PA 915 GK20121-PA 44..915 60..825 1044 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17159-PA 845 GE17159-PA 1..845 1..825 3349 78.1 Plus

FI05801.hyp Sequence

Translation from 250 to 2727

> FI05801.hyp
MNSRRIALVLLIGIIVSFSGHDALTYPERFDRLPTWGGHSQIGGPLLDTA
HRENREKRENRVDLCRHCFCIHLKAICDYKLNKTLPNEFNDKLLVPLNIK
YIEVRLTVGTQFVMYENFFQDNQVNYFGVIGVGKDDQVEITSNAFSHNKG
GFPNIEIRNVLRVFLREKFLTGADYKLLVEDVTQLSVFSNALQMTNLDCS
LKRIKELNLMKNAFNPGVAKYGINLRIEDSNINQLGIFGVSMGKVSLLRC
HIDMIMSNAFDVTSIKELIIEGCNIEVIESQALTNKLHSDKVAIVDTVIG
TIEGQAISQSGITTMIMFGNTITKIRSNAIQIVAVSLFIRNNSMSHVEPN
WLSVSQADQVEIANNRFEDYGRCELNIGSSNCSFRNNILQNPQSGSLNFT
CRVHQVRVGTECSCNKSWLSELTDHDLESEIMCQVAKRDANCFNATNTDV
RRYVNEACGSNVTRYCMGGQWVTKAVSDHSSDSSKLTIGMIALEIVILTL
LLVAIVCVLAKNCGSGSCAPAGGQSTDNCLIEEDIRNSLRQLALHSESNK
TRKAILKLINGHLSKGECNDRILFIVDNMPQNQAIESLLFRHISQSHMEP
SDSEAYASTALTANATAPPLPPSTDSSEPIYQELDQQRLIIDDKYSLPLN
SDEDPPYSEPSNMMNTNDMPPAYQYATPMRILPCHQMQHQQPSTTANYAI
PVWRSTPSATPTSRPPSGSQEGSATATAPRAVKDLRQALQNSPQFHPNQL
TSTRNQRQILQILPPLQPPPYTQRSQVRGQRRRSFECLDGAASLAAMEHM
DSGSDHSGGSDVTVQIADVIDYADA*

FI05801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
be-PF 825 CG32594-PF 1..825 1..825 4290 100 Plus
be-PC 825 CG32594-PC 1..825 1..825 4290 100 Plus
be-PB 700 CG32594-PB 1..665 1..665 3441 99.8 Plus