Clone FI05802 Report

Search the DGRC for FI05802

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:58
Well:2
Vector:pOT2
Associated Gene/TranscriptVps36-RA
Protein status:FI05802.pep: gold
Sequenced Size:1361

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Vps36 2008-08-15 Release 5.9 accounting
Vps36 2008-12-18 5.12 accounting

Clone Sequence Records

FI05802.complete Sequence

1361 bp assembled on 2008-08-14

GenBank Submission: BT044237.1

> FI05802.complete
ACGGTGGAGTCACGAAAGATGTGTCATCTCCAGCCAGAGCCACAACAAAA
CAAATATTAAGGATAAAATAACAAATATCTGAAATGAATCGCTTCGCTTA
TGTGGAGGCCCGTCTGAGTCCCAATGAATCCTTCGTCAGCCGCGACAACA
GGGTAAAAATATACGATGGCGACCAAAAGACGGACTTTGAAGACGGCGAA
GTGGTGCTCACCACACACCGACTGTTTTGGGGTCGCCCTGGAGAGATTGC
CCGGGCCGCCGTAACACTTTGCCTGCCACTCAGCTATGTGATATCCGTCA
GCGAAGAGACTACTGCCTCTAACTTCTTTGGCCGCAAGACTCGCATAATC
ATGCATCTGCATCCTCCAACGTCGGACAAAGGACCCGGCCCACTGGACAC
CAGTCGCGCCACCCACATCAAACTGTCGGGCAAGAATGGCCTGAGTGTCG
AGTTCCACAGTGCCTTGCGGGAGACTCTAAATGCCCGCGTCTGGGAAATC
CTCTTGACCAGCGAGATCATCATCAATGGCGTGGCCAGCAGTCCAACCTT
GGAGCCTGCCAACGACAGGCTGGCCCGCATTCAGAAGAGGACAGGAATTG
GGGGCATCGAACGGCATTTGGAGGCAAAAGCCAAGGCCACGGATGAGAAC
ATAGCACTTGCCTTTCAGGATCTCAGTGTTCTAATGGCCATGGCCAAGGA
CATGGTAGGAGTGTCCAAGACAATAAGCAGCAAGATACGCAAACAGAAGG
GAGAAATATCTGACGATGAAACGGTGCGTTTCAAATCCTACCTCATGAGC
CTGGGCATCGATGATCCCGTCACGCGGGACAACTTTACCAGCAATTCTGC
CTACTTCAGTAGCCTGGCCCGACAGATTTGCGAAATGCTGCTGGATCCTA
TCGAGGAGCAAGGTGGCATGATGTCCTTGGCTGATGTCTACTGTCGTGTA
AACCGCGCTCGTGGTCTGGAACTGCTATCGCCTGAGGACTTGCTGCACGC
CTGCGAGCAGCTTAGTGGTCCAATACGCCTGCGCAGCTTTCCCAGTGGCG
CTAGAGTGCTACAACTGGAGTCCCACGATGATGCCCTAATTGCCGTTGAC
ACATTGGAGAAGGTGGAGGCTGCCGAGTCTCTGGCTGTGGAGGAACTGGC
CAAGCAGCTGGGAATTTCACTCCTGCTGGCCAAGGAGCGATTGCTAGTGG
CCGAACGTTTGGGCAAGGTGTGTCGCGACGAGTCCGTAGAGGGACTGCGG
TTCTATCCAAATCTTCTGCTAGGCCGGGACTAATTTCAATGTGAATGTGT
GCTTGTTGTTATGGTTAATAAAGATATTTGACTTTTTATTTAAAAAAAAA
AAAAAAAAAAA

FI05802.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-RA 1531 Vps36-RA 49..1392 1..1344 6720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13502355..13503083 906..178 3615 99.7 Minus
chr3L 24539361 chr3L 13501862..13502299 1341..904 2130 99.1 Minus
chr3L 24539361 chr3L 13503145..13503323 179..1 880 99.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-RA 1200 CG10711-PA 1..1200 84..1283 6000 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-RA 1346 CG10711-RA 6..1346 1..1341 6705 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-PA 399 CG10711-PA 1..399 84..1280 1912 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13512139..13512867 906..178 3645 100 Minus
3L 28110227 3L 13511643..13512083 1344..904 2205 100 Minus
3L 28110227 3L 13512929..13513107 179..1 895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13505239..13505967 906..178 3645 100 Minus
3L 28103327 3L 13504743..13505183 1344..904 2205 100 Minus
3L 28103327 3L 13506029..13506207 179..1 895 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:19:33 has no hits.

FI05802.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:49:55 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13503145..13503323 1..179 99   Minus
chr3L 13502356..13503081 180..905 99 <- Minus
chr3L 13501862..13502297 906..1341 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:28 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1200 84..1283 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:00 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1200 84..1283 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:21 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1200 84..1283 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:23 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1200 84..1283 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:55 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1200 84..1283 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:02 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1341 1..1341 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:00 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1341 1..1341 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:21 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 6..1346 1..1341 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:06 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 1..1341 1..1341 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:55 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 6..1346 1..1341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:49:55 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13512929..13513107 1..179 100   Minus
3L 13512140..13512865 180..905 100 <- Minus
3L 13511646..13512081 906..1341 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:21 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13506029..13506207 1..179 100   Minus
arm_3L 13505240..13505965 180..905 100 <- Minus
arm_3L 13504746..13505181 906..1341 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:10 Download gff for FI05802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13506029..13506207 1..179 100   Minus
3L 13505240..13505965 180..905 100 <- Minus
3L 13504746..13505181 906..1341 100 <- Minus

FI05802.pep Sequence

Translation from 83 to 1282

> FI05802.pep
MNRFAYVEARLSPNESFVSRDNRVKIYDGDQKTDFEDGEVVLTTHRLFWG
RPGEIARAAVTLCLPLSYVISVSEETTASNFFGRKTRIIMHLHPPTSDKG
PGPLDTSRATHIKLSGKNGLSVEFHSALRETLNARVWEILLTSEIIINGV
ASSPTLEPANDRLARIQKRTGIGGIERHLEAKAKATDENIALAFQDLSVL
MAMAKDMVGVSKTISSKIRKQKGEISDDETVRFKSYLMSLGIDDPVTRDN
FTSNSAYFSSLARQICEMLLDPIEEQGGMMSLADVYCRVNRARGLELLSP
EDLLHACEQLSGPIRLRSFPSGARVLQLESHDDALIAVDTLEKVEAAESL
AVEELAKQLGISLLLAKERLLVAERLGKVCRDESVEGLRFYPNLLLGRD*

FI05802.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10968-PA 400 GF10968-PA 1..397 1..396 1842 88.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13759-PA 399 GG13759-PA 1..399 1..399 2060 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16680-PA 398 GH16680-PA 1..396 1..399 1805 86.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-PA 399 CG10711-PA 1..399 1..399 2004 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11366-PA 400 GI11366-PA 1..396 1..399 1810 85.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21669-PA 399 GL21669-PA 1..399 1..399 1921 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10514-PA 399 GA10514-PA 1..399 1..399 1921 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24585-PA 399 GM24585-PA 1..399 1..399 2071 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12653-PA 100 GD12653-PA 3..100 302..399 490 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11621-PA 398 GJ11621-PA 1..396 1..399 1837 87.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17104-PA 400 GK17104-PA 1..395 1..396 1871 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20055-PA 399 GE20055-PA 1..399 1..399 2075 98.5 Plus

FI05802.hyp Sequence

Translation from 83 to 1282

> FI05802.hyp
MNRFAYVEARLSPNESFVSRDNRVKIYDGDQKTDFEDGEVVLTTHRLFWG
RPGEIARAAVTLCLPLSYVISVSEETTASNFFGRKTRIIMHLHPPTSDKG
PGPLDTSRATHIKLSGKNGLSVEFHSALRETLNARVWEILLTSEIIINGV
ASSPTLEPANDRLARIQKRTGIGGIERHLEAKAKATDENIALAFQDLSVL
MAMAKDMVGVSKTISSKIRKQKGEISDDETVRFKSYLMSLGIDDPVTRDN
FTSNSAYFSSLARQICEMLLDPIEEQGGMMSLADVYCRVNRARGLELLSP
EDLLHACEQLSGPIRLRSFPSGARVLQLESHDDALIAVDTLEKVEAAESL
AVEELAKQLGISLLLAKERLLVAERLGKVCRDESVEGLRFYPNLLLGRD*

FI05802.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-PA 399 CG10711-PA 1..399 1..399 2004 100 Plus