Clone FI05810 Report

Search the DGRC for FI05810

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:58
Well:10
Vector:pOT2
Associated Gene/TranscriptCG6356-RA
Protein status:FI05810.pep: gold
Sequenced Size:2545

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6356 2008-08-15 Release 5.9 accounting
CG6356 2008-12-18 5.12 accounting

Clone Sequence Records

FI05810.complete Sequence

2545 bp assembled on 2008-08-11

GenBank Submission: BT044239.1

> FI05810.complete
AACCACAATCAACACAAAAAGAAAAAAAGAAAAAATTAATATATTTCGAC
CTGTAGTCGAGGGCGAAAGTGAAAGTGTACATCTCTTATCTCCCACCTCT
GCCCATAGTGAATGCACTTCAGCGAAGCTACAACACTGGGTTCCTAAGCC
CCCGAATCGTATCAGAATTCAAATCCGCAGATCTGTGTTTTTTGCACGAG
TTCAAAAATAGATTGCACAGCCGAGGAATTCAAGTTCAGTGGCACAGGCA
GAACCTCCCGAGCAATCTGAACATTTCGTTTGCGTGGGGTCAGTCGTCTG
CCTCATACAACATCCTCAACATCATCATCATCATCGTCTTCAGAGTCTGC
GACAAACGAAAAGATTTTGAATTTTGAATAGCCCAAGTAAAAGTAGAAGT
AGCAGCTAGCATCATGACTCAATCCACGGAGAATCCGGAGAAGAATCGCG
AGCTGATCAGCGAGGAAAGCATGAAGGATCTGCTCACCAAGCAGCTGGAA
GTCGTTGGCAGTGGCGGGGCATTTGTGTGGGCGATCTTCTTCCTGTGTGT
CACTCCCAATATACTGAACGGATTCCATGTGTCATCCTATACGCTGCTGG
GCCACCTACCCGATGACCAGTGGTGCGGCATTCCGGAGCTGCAGGACACC
AACTGGACACACGCCCAGAAGCGGGAGATTGTCGCCAAGGGATTGGATTC
GGGCGGTTGCACCGTGTGGGACTGGAACTATGGCCACCTGGCCAAGATGT
CCTACGAGGCAGCCCTGAACTATACCGGCCATCTGACGCAGATTTCCCCG
CCGGCTGAGGTATCCTGCCGTGTAAAGGGGCAACATGAGTTCGCCCATCC
CGAGACCACCTTCGTTGCGGACTGGGATCTCACCTGCGACCGGAGCATCC
AGCGTACCTCCGCCCAGGTTTCCATATCGTTGGGCAAGTTCTGCGGATCC
TTCTCCTTTGGCATCCTGGCCGACAAATTTGGTCGCAAATCCTCATTCAC
CCTGGGCGCTGCCTTCTTTATTGTGGGCAGCTTCTTCTGTACCTTCTCGC
CCTGGTACAGCCTCTTCCTGGCCGGACGTTTCGCCCTAGGAGCAGCCTCC
TCTGGTCTGTTCTATCCAGCATTTACCATGATCGTGGAGAACATCTGCTT
GAAGCATCGTTCCTGGATGTCCATTGCCTTCTCAGCGTCCTATCCGGTGG
GCATGATCATCCTGGCCATTGTGGGCTACGTCATCCAACCGTGGAGACAT
CTGCAACTGGCTCTCACCATTCCTTCGCTGCTGCTCATTCTGAACTGCTA
CCTGATGAGTGAGTCACCCCGCTGGCTGATCACGAACCAAAGATATGATC
GCGTCTACAAGATTCTCTTCAGACAGCCCAGCCATTACCAAATTCAGCCC
GCCGTTGCAGCCCCATCTCAAGTCGCCAGCGATAAGAAGTCGCTGGAGCC
CGAAGAGGGATTCTCCTTTGGACAGAAACTCAAGAATGGTCCCCTGAAGT
CCATCATCGAGCTGTATGCCAACTCCAAGGTGCGCAGGATGATCTTTGCC
TCGTATTTCATGTTCTGTGTCACTTCGCTGAGTTACTATGTGACGGCTCT
CAATGCCGCCAATTTGTCGGTGTCCAGATACCTATACATTATAGGCACCG
GTCTGGTGGATATACCCTCCTATCTCGTCCCTGTGATAATGCTGCGCTTT
ACGGGCCGTCGCCTCACCACCATGTTCCTGTTCCTGTGGACCGGCGTGTC
CTTGCTGCTTGTCCTTGCTGTTCCCGCCGGCAGCACCACCTGGATCGTGG
CCTTCGCCATGCTGGGTCGCTTTGGTATTAGCGCCACCTACTCCGTGGTC
ACGCTCTACACAGCCGAGCTGTATCCCACCCAGATAAGAAACTCGGCTTT
GGGAACCTGCTCCACCTTCGCCCATGTGGGCTCCATTTCGGCACCGTATG
TGGTCGATGTCCTTGGAGCTCTGGGCTGGTACATTCCAACAACGATTTGC
GGCTGCTGCGTTCTAGTAGCTGGCCTACTGACTCTCACACTTCCGGAAAC
GGGAACGGGTAAGCTGTCCGACAAAGTGGAGAGCAGTGCGTCCTCCACTC
CGACGGAGCCGGCCGAGAAACAGTGATGACAGCAATAGGTTAAGTTCCAT
TTCCACGACTAAACTGATTAACTACTTTTTAAGGTATACGAACATAGGTA
TTACGACCCAAAAACTTCTGTACCTCCAACTGACTTTCGCTATTTAAATT
GTTTTACAATCCGAAACACTTTCAAAAGAAAAACAATTATTGGTTGAAAT
GAAAGTGTTCTAAAGAAAAGACAAAACTGATAAAAAAAAGTCGTGAAAAT
GGTTAGTTAGTCTAATGTAAATCTAGCTATATATACCTACAGTAATTAGG
CGTAAGTTTGTTAGTTTCTGCTATTCCTGCATTGTTTAAGTAAATATTCA
TAATTGTTTTTCTGTTTGATATCGCATAATAAATATACTATTTATATGTA
TGTGATCGCCAGAGATCTAGGACTGCAAAAAAAAAAAAAAAAAAA

FI05810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-RA 2784 CG6356-RA 183..2709 1..2527 12635 100 Plus
CG6356.b 3229 CG6356.b 628..3154 1..2527 12635 100 Plus
CG6356.a 3003 CG6356.a 402..2928 1..2527 12635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20111044..20111974 1596..2526 4640 99.9 Plus
chr3R 27901430 chr3R 20107698..20108226 1..530 2600 99.8 Plus
chr3R 27901430 chr3R 20109647..20110094 529..976 2240 100 Plus
chr3R 27901430 chr3R 20110371..20110539 1132..1300 815 98.8 Plus
chr3R 27901430 chr3R 20110159..20110313 977..1131 775 100 Plus
chr3R 27901430 chr3R 20110831..20110985 1442..1596 760 99.4 Plus
chr3R 27901430 chr3R 20110602..20110743 1301..1442 710 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-RA 1713 CG6356-PA 1..1713 414..2126 8565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-RA 2887 CG6356-RA 362..2887 1..2526 12630 100 Plus
CG34290-RB 932 CG34290-RB 868..932 2526..2462 325 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-PA 570 CG6356-PA 1..570 414..2123 2734 100 Plus
Orct-PB 548 CG6331-PB 10..496 504..2021 412 26.7 Plus
Orct-PA 548 CG6331-PA 10..496 504..2021 412 26.7 Plus
Orct2-PB 567 CG13610-PB 10..502 504..2021 407 27.4 Plus
Orct2-PA 567 CG13610-PA 10..502 504..2021 407 27.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24287687..24288618 1596..2527 4660 100 Plus
3R 32079331 3R 24284316..24284845 1..530 2650 100 Plus
3R 32079331 3R 24286280..24286727 529..976 2240 100 Plus
3R 32079331 3R 24287004..24287172 1132..1300 845 100 Plus
3R 32079331 3R 24286792..24286946 977..1131 775 100 Plus
3R 32079331 3R 24287474..24287628 1442..1596 775 100 Plus
3R 32079331 3R 24287235..24287376 1301..1442 710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24028518..24029449 1596..2527 4660 100 Plus
3R 31820162 3R 24025147..24025676 1..530 2650 100 Plus
3R 31820162 3R 24027111..24027558 529..976 2240 100 Plus
3R 31820162 3R 24027835..24028003 1132..1300 845 100 Plus
3R 31820162 3R 24027623..24027777 977..1131 775 100 Plus
3R 31820162 3R 24028305..24028459 1442..1596 775 100 Plus
3R 31820162 3R 24028066..24028207 1301..1442 710 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:03:04 has no hits.

FI05810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:27:04 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20111045..20111974 1597..2526 99   Plus
chr3R 20110832..20110985 1443..1596 99 -> Plus
chr3R 20110602..20110743 1301..1442 100 -> Plus
chr3R 20110371..20110539 1132..1300 98 -> Plus
chr3R 20110159..20110313 977..1131 100 -> Plus
chr3R 20109648..20110094 530..976 100 -> Plus
chr3R 20107698..20108225 1..529 92 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:31 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 1..1713 414..2126 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:06 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 1..1713 414..2126 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:02 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 1..1713 414..2126 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:23 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 1..1713 414..2126 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:04 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 1..1713 414..2126 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:33 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 183..2708 1..2526 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:05 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 183..2708 1..2526 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:02 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 362..2887 1..2526 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-11 09:29:32 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 183..2708 1..2526 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:04 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 362..2887 1..2526 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:27:04 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24287688..24288617 1597..2526 100   Plus
3R 24287475..24287628 1443..1596 100 -> Plus
3R 24287235..24287376 1301..1442 100 -> Plus
3R 24287004..24287172 1132..1300 100 -> Plus
3R 24286792..24286946 977..1131 100 -> Plus
3R 24286281..24286727 530..976 100 -> Plus
3R 24284316..24284844 1..529 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:02 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20113410..20114339 1597..2526 100   Plus
arm_3R 20113197..20113350 1443..1596 100 -> Plus
arm_3R 20112957..20113098 1301..1442 100 -> Plus
arm_3R 20112726..20112894 1132..1300 100 -> Plus
arm_3R 20112514..20112668 977..1131 100 -> Plus
arm_3R 20112003..20112449 530..976 100 -> Plus
arm_3R 20110038..20110566 1..529 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:04 Download gff for FI05810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24028519..24029448 1597..2526 100   Plus
3R 24028306..24028459 1443..1596 100 -> Plus
3R 24028066..24028207 1301..1442 100 -> Plus
3R 24027835..24028003 1132..1300 100 -> Plus
3R 24027623..24027777 977..1131 100 -> Plus
3R 24027112..24027558 530..976 100 -> Plus
3R 24025147..24025675 1..529 100 -> Plus

FI05810.pep Sequence

Translation from 413 to 2125

> FI05810.pep
MTQSTENPEKNRELISEESMKDLLTKQLEVVGSGGAFVWAIFFLCVTPNI
LNGFHVSSYTLLGHLPDDQWCGIPELQDTNWTHAQKREIVAKGLDSGGCT
VWDWNYGHLAKMSYEAALNYTGHLTQISPPAEVSCRVKGQHEFAHPETTF
VADWDLTCDRSIQRTSAQVSISLGKFCGSFSFGILADKFGRKSSFTLGAA
FFIVGSFFCTFSPWYSLFLAGRFALGAASSGLFYPAFTMIVENICLKHRS
WMSIAFSASYPVGMIILAIVGYVIQPWRHLQLALTIPSLLLILNCYLMSE
SPRWLITNQRYDRVYKILFRQPSHYQIQPAVAAPSQVASDKKSLEPEEGF
SFGQKLKNGPLKSIIELYANSKVRRMIFASYFMFCVTSLSYYVTALNAAN
LSVSRYLYIIGTGLVDIPSYLVPVIMLRFTGRRLTTMFLFLWTGVSLLLV
LAVPAGSTTWIVAFAMLGRFGISATYSVVTLYTAELYPTQIRNSALGTCS
TFAHVGSISAPYVVDVLGALGWYIPTTICGCCVLVAGLLTLTLPETGTGK
LSDKVESSASSTPTEPAEKQ*

FI05810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16122-PA 570 GF16122-PA 1..570 1..570 2733 88.6 Plus
Dana\GF16120-PA 550 GF16120-PA 10..535 31..568 530 28.8 Plus
Dana\GF11741-PA 501 GF11741-PA 69..491 126..560 461 29.2 Plus
Dana\GF16119-PA 568 GF16119-PA 118..513 151..546 428 30.8 Plus
Dana\GF23176-PA 555 GF23176-PA 7..517 20..560 421 26.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11274-PA 570 GG11274-PA 1..570 1..570 2942 96 Plus
Dere\GG11272-PA 548 GG11272-PA 10..533 31..569 528 27.8 Plus
Dere\GG11271-PA 568 GG11271-PA 10..512 31..546 460 27.4 Plus
Dere\GG22009-PA 502 GG22009-PA 55..493 122..560 452 28 Plus
Dere\GG20124-PA 555 GG20124-PA 7..517 20..560 413 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14187-PA 577 GH14187-PA 1..569 1..569 2531 81 Plus
Dgri\GH14185-PA 559 GH14185-PA 10..529 31..560 529 28.3 Plus
Dgri\GH20518-PA 601 GH20518-PA 7..536 28..560 438 25.9 Plus
Dgri\GH23022-PA 497 GH23022-PA 68..490 126..560 437 28.6 Plus
Dgri\GH22909-PA 585 GH22909-PA 134..563 135..566 420 29.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-PA 570 CG6356-PA 1..570 1..570 2984 100 Plus
Orct-PB 548 CG6331-PB 10..533 31..569 553 27.2 Plus
Orct-PA 548 CG6331-PA 10..533 31..569 553 27.2 Plus
Orct2-PB 567 CG13610-PB 10..512 31..546 541 28.4 Plus
Orct2-PA 567 CG13610-PA 10..512 31..546 541 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22097-PA 568 GI22097-PA 1..568 1..570 2483 81.1 Plus
Dmoj\GI22094-PA 558 GI22094-PA 10..516 31..546 492 29.7 Plus
Dmoj\GI22093-PA 554 GI22093-PA 114..524 151..568 427 27.5 Plus
Dmoj\GI10092-PA 555 GI10092-PA 7..517 20..560 419 26.3 Plus
Dmoj\GI21063-PA 603 GI21063-PA 7..536 28..560 416 25.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23364-PA 578 GL23364-PA 1..558 1..556 2639 87.1 Plus
Dper\GL10363-PA 621 GL10363-PA 212..611 147..557 473 30 Plus
Dper\GL23362-PA 528 GL23362-PA 132..510 184..567 472 31.4 Plus
Dper\GL23361-PA 565 GL23361-PA 10..515 31..546 455 28.7 Plus
Dper\GL10508-PA 555 GL10508-PA 133..550 140..558 406 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19535-PA 578 GA19535-PA 1..559 1..557 2650 87.1 Plus
Dpse\GA19517-PA 556 GA19517-PA 10..538 31..567 561 28.6 Plus
Dpse\GA21239-PA 509 GA21239-PA 100..499 147..557 467 29.7 Plus
Dpse\GA12403-PA 565 GA12403-PA 10..515 31..546 454 28.5 Plus
Dpse\GA19374-PA 555 GA19374-PA 7..517 20..560 426 27.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26583-PA 570 GM26583-PA 1..570 1..570 2997 98.4 Plus
Dsec\GM26581-PA 548 GM26581-PA 10..533 31..569 517 27.6 Plus
Dsec\GM21988-PA 502 GM21988-PA 55..493 122..560 446 27.8 Plus
Dsec\GM26580-PA 421 GM26580-PA 6..367 185..546 407 30.3 Plus
Dsec\GM25727-PA 542 GM25727-PA 1..504 31..560 405 26.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21085-PA 562 GD21085-PA 1..562 1..570 2915 96.3 Plus
Dsim\GD11488-PA 502 GD11488-PA 55..493 122..560 442 27.8 Plus
Dsim\GD21082-PA 566 GD21082-PA 10..512 31..546 442 27.5 Plus
Dsim\GD20304-PA 555 GD20304-PA 7..517 20..560 403 26.1 Plus
Dsim\GD19077-PA 564 GD19077-PA 71..563 52..570 396 24.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24211-PA 572 GJ24211-PA 1..572 1..570 2578 83.4 Plus
Dvir\GJ24209-PA 556 GJ24209-PA 10..529 31..560 541 28 Plus
Dvir\GJ20940-PA 496 GJ20940-PA 87..489 147..560 450 30.3 Plus
Dvir\GJ20939-PA 497 GJ20939-PA 88..490 147..560 440 30.3 Plus
Dvir\GJ21470-PA 577 GJ21470-PA 14..548 28..558 439 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11739-PA 578 GK11739-PA 1..578 1..570 2588 82.4 Plus
Dwil\GK11735-PA 559 GK11735-PA 10..530 31..560 578 28 Plus
Dwil\GK11736-PA 557 GK11736-PA 7..530 28..560 523 28.4 Plus
Dwil\GK11734-PA 568 GK11734-PA 5..514 26..546 476 28.4 Plus
Dwil\GK15896-PA 509 GK15896-PA 61..499 122..560 449 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23467-PA 570 GE23467-PA 1..570 1..570 2867 95.6 Plus
Dyak\GE23464-PA 549 GE23464-PA 10..533 31..569 525 27.2 Plus
Dyak\GE12087-PA 502 GE12087-PA 55..493 122..560 463 28.3 Plus
Dyak\GE23463-PA 568 GE23463-PA 117..512 151..546 451 31.2 Plus
Dyak\GE26331-PA 555 GE26331-PA 7..517 20..560 413 26.4 Plus

FI05810.hyp Sequence

Translation from 413 to 2125

> FI05810.hyp
MTQSTENPEKNRELISEESMKDLLTKQLEVVGSGGAFVWAIFFLCVTPNI
LNGFHVSSYTLLGHLPDDQWCGIPELQDTNWTHAQKREIVAKGLDSGGCT
VWDWNYGHLAKMSYEAALNYTGHLTQISPPAEVSCRVKGQHEFAHPETTF
VADWDLTCDRSIQRTSAQVSISLGKFCGSFSFGILADKFGRKSSFTLGAA
FFIVGSFFCTFSPWYSLFLAGRFALGAASSGLFYPAFTMIVENICLKHRS
WMSIAFSASYPVGMIILAIVGYVIQPWRHLQLALTIPSLLLILNCYLMSE
SPRWLITNQRYDRVYKILFRQPSHYQIQPAVAAPSQVASDKKSLEPEEGF
SFGQKLKNGPLKSIIELYANSKVRRMIFASYFMFCVTSLSYYVTALNAAN
LSVSRYLYIIGTGLVDIPSYLVPVIMLRFTGRRLTTMFLFLWTGVSLLLV
LAVPAGSTTWIVAFAMLGRFGISATYSVVTLYTAELYPTQIRNSALGTCS
TFAHVGSISAPYVVDVLGALGWYIPTTICGCCVLVAGLLTLTLPETGTGK
LSDKVESSASSTPTEPAEKQ*

FI05810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-PA 570 CG6356-PA 1..570 1..570 2984 100 Plus
Orct-PB 548 CG6331-PB 10..533 31..569 553 27.2 Plus
Orct-PA 548 CG6331-PA 10..533 31..569 553 27.2 Plus
Orct2-PB 567 CG13610-PB 10..512 31..546 541 28.4 Plus
Orct2-PA 567 CG13610-PA 10..512 31..546 541 28.4 Plus