Clone FI05907 Report

Search the DGRC for FI05907

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:59
Well:7
Vector:pOT2
Associated Gene/TranscriptCG4984-RA
Protein status:FI05907.pep: gold
Sequenced Size:3130

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4975 2008-08-15 Release 5.9 accounting
CG4984 2008-08-15 Release 5.9 accounting
CG4984 2008-12-18 5.12 accounting
CG4975 2008-12-18 5.12 accounting

Clone Sequence Records

FI05907.complete Sequence

3130 bp assembled on 2008-07-17

GenBank Submission: BT044241.1

> FI05907.complete
CGAGATTTATTTAAATAAATGATTTACCCCAGAAAAGCGAAACTAAAGAG
CTGGTACACAAGCTCGTGCGCCTGAGCATAACCGAAAATGAGGAGGAAAT
CTCGGCATTACTCAAGAACCTACGACTTTTGCTCACAAAAGGCAGGGAAA
ACCAAGAGACTTTGGCTGAAAGTGCGGAGTTTTCCAGCTTTTTAAATGCT
GTGGCTTTCAGTCCAGTGATGCGCACGGAGCATCGGCTTATACACAATCT
ATCTCTGCAGGTGCTAGCCAATAGTGTGGTTAACAATGAGACCACCCAAG
CACTTATCTGGAGTCAGCATGGCTTGAAGATCGCCGAACAAGCTTACGCT
TCTCCCTTGGGAAGTTCGAATAATGTGCTCCTCATGATCATGTACAACAT
ATATCTCAGTGGTCATGGTCTTATCACCGACTTGGTGGCACTTAAAACTT
GTCTGCAACTGTGGCGAGCTCTAAACGAAGCCCAGTGCACCTATAACTTC
GAGTATCTACACTTCTTCCTGGAGCACTTCATTGTCCAGAATGGACGAGC
CTGCGTAGCTTGTTACCAAAAGCTGGAGACTGAAGATCGTGTTGCTTTCC
TCGACTACGTGGCCCACTATCTGAGGGAAAACAGTCCCAATGGTGATGTT
ACGCTGTTTTTACTGCAGCACTTTGCTAAAGAATTCCGCATGAAATCCGA
TTGCCTCCTGCGTGAAACGATAAAGCTTAAGCATGAGCTTCATCCACGTG
AAGTTCACACCTTACTGCGCATCATCGCAAGTGCAAGCGGCTCAGAGAAG
TATGCTAATGTATATCCCAACGACCAATCGCTGTTCATCAACGTGAGCAG
CCTGCTGAGATGCATTGTGTCTGCTGGCAAGGAACCGGATGGAGGCGGCC
TTGATAAGCCCATGACGAAGCTGGAAGAGGTGGCACTCACTTCGGACATT
GATGCGGGCTACGAAAAAAAGGTGTCCTATGAACTCAAAACGTTACTCGT
ACGCTGCTCCGCCAATCTTCTGTATGACAACAAGGCCAACAAGGGATACT
GCCTGGACACACAGCTGCTGCCCACGCTTCTTGAATGCACAACGATGGAT
GCTCGAAACCCATTGATGCGGGAGTGGAGCATCTTGGCCATCCGAAACGC
CTGCATCAACTGTCCGGAGGCGCAACAGGTGATCGCTGGCCTGACTATGC
AGGGCTCCGCGCCCAACGACATCCTCACCGAACTCAACCTGGACATGGGA
GCACTACGCATCTCCGACAGGCAGCAATAGTTTCGAGCATACAGCATACA
GCATACGTCTACCCATGAGAAATTGGCAAACGAGCCATGACCACTGGCTG
GCCAACAAGTGGTTAGATGTTATTCACACCACGTCATGCTCCTCGCAGTC
GTTGCCCCCCTTTTCGGGCTTTACGATGCGCTAATGGCATGCCAACAGAT
AGCCAAAGGCATTCATAAAAGCGATGTCAACGTTTAATGGAACGTGCGCT
GTTCCATGTGCGTGTGGATTGCCCCTTGCCAACGTCCAGAGAGCCATAGG
AGTGGAGCGTGATCCGGAAACAGCGACGACACAATCAGGATGAAGCGCGA
CGTGTCCACGTCGACCATCGGCCGGGATGAGGCCCGTCGTCCGCTGATGG
AGGCCTACATGTTCCAGCGGCGCGTGCTGCTCGGCTGCAGTCTGCTCATG
GTGGTTTCGCTGCTAATCTGGATAGTGGCCATCTCGACCGATCACTGGAT
CATCATATCCGGCGGAAAGGGCATTTTTATACCCGAATCTCGACGCTTCT
TTATGTCCTCGCACTCGGGCTTGTGGCGCCACTGCCGGAACACGATAGTG
CCCAATGCCATGAGCAATGCCCAGGTGGTGCGCAACTTTAGCTCCATGTC
GTACACATCGCAGACGAACATCAACGAGGCGAAGCGGAATCTCTCGCAAA
TGGACTTCATCAAGGAGTTCGCGCACGAGAAGCTGGAAACGTCGGACAAC
TTTACGGAATCGGCGCGTCGCCACATGTTTGCCCATTGGGTACGGGGCGA
GGATATGGAGTTCCAGACGCTGCGCCATGCCTTTCGCACCCTGGTGATGA
ACACCGAGGAGAATCAGCGGCAGTTTAATGCCACGGCCATTAAGCCCATA
CCCATCAATCCGCTGGACGTGCAGGGAATCATTGAGAGAAATACTTTCGG
TTCGGCGCTGCAGCGGGTTAAGTACAACAACACTTGGTCTTACTACGTGA
TCCCGGAGGTGGCGCAGTTAGCCATCTTCAGGAACTGGACGGATTACCCA
CTGGTGGTACGACTGCTGGGCACCTACATCCGGGATATCAGCATCCCGGC
CTACGTGCTTAACGATGAACGGGTGATACTTATCCTAGTGCCACCGCTGC
CGCCCAAGAAGGGTCAGCCCGCCTACTACAGCTATATACCGAACCAGCGC
TGCAAATACATCGACATGTTCCCCAACTCCAATGCTCTGCGAAATGAGCC
CGGTTTCGATGACGAACTATTGGACTATATCCGGACGCAGGCGTCCTTTG
CCTGCATAACACTGTTCGTGATGAGCTTGGGTGCCGTCTTCTCCTTCTAC
ACGTTCATGAATCCGCGCTACATGTTCAAGCGTCTGGCGGGTGGCATCCA
CTTGGTGGCTGCCTCCACGGCGCTGGTGGTTCTCCAGGTGCTCTTCTCCT
CGATTGACTACACCAAAGAGCATCTGTTCTATGCGTATCCTGAAGGGGCG
CAACTAACTTATGGCTACGGCGTTTATTTGGCCTGGTTCACGTTCGTGGA
CAATATCCTGTGCGGTGTTATGTTCCTCTGGTATTCTGGCAAGAAGAAGG
GTGCCAAGGCGCCCAACGACGAGGTGGCCATGGCCGACGAGCCGACCATC
ATGGGCAGATAACTGGTAACCGGATATCTTTTTGATGGTATTACCTAATG
CCCATACTGCGACCAAAGACCAAAGCAATTGGCTAACTATCCGCCATTGC
TTATCATTTCACTTTTGTTATTTGTTGTTTTCATAATGGCTGTATTTAAA
ATGTTCGCTTTATAACTTTAAGAATCTCAATGCAATAAAGGAATTGTTTT
CAGTCAGTAAAAAAAAAAAAAAAAAAAAAA

FI05907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-RB 3108 CG4984-RB 1..3108 1..3108 15195 99.2 Plus
CG4975-RB 3108 CG4975-RB 1..3108 1..3108 15195 99.2 Plus
CG4984-RD 3129 CG4984-RD 1..2523 1..2523 12270 99 Plus
CG4984-RD 3129 CG4984-RD 2544..3129 2523..3108 2930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 01:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13614113..13615225 1..1113 5565 100 Plus
chr2R 21145070 chr2R 13618599..13619274 1770..2445 3230 98.5 Plus
chr2R 21145070 chr2R 13615287..13615663 1114..1490 1750 97.6 Plus
chr2R 21145070 chr2R 13619771..13620120 2759..3108 1750 100 Plus
chr2R 21145070 chr2R 13618236..13618518 1489..1771 1385 99.3 Plus
chr2R 21145070 chr2R 13619477..13619717 2523..2763 1190 99.6 Plus
chr2R 21145070 chr2R 13619331..13619408 2446..2523 360 97.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-RB 1323 CG4984-PB 1..1323 1590..2912 6405 98.9 Plus
CG4984-RA 1323 CG4984-PA 1..1323 1590..2912 6405 98.9 Plus
CG4975-RE 1257 CG4975-PE 12..1254 32..1274 6170 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-RB 3112 CG4984-RB 36..3112 32..3108 15040 99.3 Plus
CG4975-RE 3112 CG4975-RE 36..3112 32..3108 15040 99.3 Plus
CG4984-RD 3133 CG4984-RD 36..3133 32..3108 14795 98.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-PB 440 CG4984-PB 1..440 1590..2909 2245 100 Plus
CG4984-PA 440 CG4984-PA 1..440 1590..2909 2245 100 Plus
CG4984-PD 447 CG4984-PD 1..447 1590..2909 2227 98.4 Plus
CG4984-PC 447 CG4984-PC 1..447 1590..2909 2227 98.4 Plus
CG4975-PE 418 CG4975-PE 5..418 33..1274 2070 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17726972..17728084 1..1113 5550 99.9 Plus
2R 25286936 2R 17731466..17732141 1770..2445 3230 98.5 Plus
2R 25286936 2R 17728146..17728522 1114..1490 1765 97.9 Plus
2R 25286936 2R 17732638..17732989 2759..3110 1760 100 Plus
2R 25286936 2R 17731103..17731385 1489..1771 1385 99.3 Plus
2R 25286936 2R 17732344..17732584 2523..2763 1190 99.6 Plus
2R 25286936 2R 17732198..17732275 2446..2523 360 97.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17728171..17729283 1..1113 5550 99.9 Plus
2R 25260384 2R 17732665..17733340 1770..2445 3230 98.5 Plus
2R 25260384 2R 17729345..17729721 1114..1490 1765 97.8 Plus
2R 25260384 2R 17733837..17734188 2759..3110 1760 100 Plus
2R 25260384 2R 17732302..17732584 1489..1771 1385 99.2 Plus
2R 25260384 2R 17733543..17733783 2523..2763 1190 99.5 Plus
2R 25260384 2R 17733397..17733474 2446..2523 360 97.4 Plus
Blast to na_te.dros performed on 2014-11-27 01:44:53 has no hits.

FI05907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:05:27 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13619771..13620120 2759..3108 100   Plus
chr2R 13619478..13619712 2524..2758 100 -> Plus
chr2R 13619331..13619408 2446..2523 97 -> Plus
chr2R 13618600..13619274 1771..2445 98 -> Plus
chr2R 13618237..13618517 1490..1770 99 -> Plus
chr2R 13615287..13615662 1114..1489 97 -> Plus
chr2R 13614113..13615225 1..1113 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:34 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RB 1..1323 1590..2912 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:41 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RA 1..1323 1590..2912 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:07 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RA 1..1323 1590..2912 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:54:10 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RB 1..1323 1590..2912 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:05:27 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RA 1..1323 1590..2912 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:18 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RB 1..3108 1..3108 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:41 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4975-RB 1..3108 1..3108 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:07 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4975-RE 36..3112 32..3108 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:54:10 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RB 1..3108 1..3108 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:05:27 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
CG4975-RE 36..3112 32..3108 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:05:27 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17732638..17732987 2759..3108 100   Plus
2R 17732345..17732579 2524..2758 100 -> Plus
2R 17732198..17732275 2446..2523 97 -> Plus
2R 17731467..17732141 1771..2445 98 -> Plus
2R 17731104..17731384 1490..1770 99 -> Plus
2R 17728146..17728521 1114..1489 97 -> Plus
2R 17726972..17728084 1..1113 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:07 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13620143..13620492 2759..3108 100   Plus
arm_2R 13619850..13620084 2524..2758 100 -> Plus
arm_2R 13619703..13619780 2446..2523 97 -> Plus
arm_2R 13618972..13619646 1771..2445 98 -> Plus
arm_2R 13618609..13618889 1490..1770 99 -> Plus
arm_2R 13615651..13616026 1114..1489 97 -> Plus
arm_2R 13614477..13615589 1..1113 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:45 Download gff for FI05907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17733837..17734186 2759..3108 100   Plus
2R 17733544..17733778 2524..2758 100 -> Plus
2R 17733397..17733474 2446..2523 97 -> Plus
2R 17732666..17733340 1771..2445 98 -> Plus
2R 17732303..17732583 1490..1770 99 -> Plus
2R 17729345..17729720 1114..1489 97 -> Plus
2R 17728171..17729283 1..1113 99 -> Plus

FI05907.pep Sequence

Translation from 1589 to 2911

> FI05907.pep
MKRDVSTSTIGRDEARRPLMEAYMFQRRVLLGCSLLMVVSLLIWIVAIST
DHWIIISGGKGIFIPESRRFFMSSHSGLWRHCRNTIVPNAMSNAQVVRNF
SSMSYTSQTNINEAKRNLSQMDFIKEFAHEKLETSDNFTESARRHMFAHW
VRGEDMEFQTLRHAFRTLVMNTEENQRQFNATAIKPIPINPLDVQGIIER
NTFGSALQRVKYNNTWSYYVIPEVAQLAIFRNWTDYPLVVRLLGTYIRDI
SIPAYVLNDERVILILVPPLPPKKGQPAYYSYIPNQRCKYIDMFPNSNAL
RNEPGFDDELLDYIRTQASFACITLFVMSLGAVFSFYTFMNPRYMFKRLA
GGIHLVAASTALVVLQVLFSSIDYTKEHLFYAYPEGAQLTYGYGVYLAWF
TFVDNILCGVMFLWYSGKKKGAKAPNDEVAMADEPTIMGR*

FI05907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11667-PA 441 GF11667-PA 1..441 1..440 2145 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21814-PA 440 GG21814-PA 1..440 1..440 2337 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21486-PA 441 GH21486-PA 1..441 1..440 2117 88.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-PB 440 CG4984-PB 1..440 1..440 2312 100 Plus
CG4984-PA 440 CG4984-PA 1..440 1..440 2312 100 Plus
CG4984-PD 447 CG4984-PD 1..447 1..440 2294 98.4 Plus
CG4984-PC 447 CG4984-PC 1..447 1..440 2294 98.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19963-PA 441 GI19963-PA 1..441 1..440 2033 86.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16795-PA 307 GL16795-PA 147..307 280..440 816 90.1 Plus
Dper\GL16795-PA 307 GL16795-PA 1..152 1..152 743 88.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18574-PA 441 GA18574-PA 1..441 1..440 2154 88.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21816-PA 440 GM21816-PA 1..440 1..440 2339 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11307-PA 440 GD11307-PA 1..440 1..440 2364 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17960-PA 441 GJ17960-PA 1..441 1..440 2103 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23258-PA 441 GK23258-PA 1..441 1..440 2073 85.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11891-PA 440 GE11891-PA 1..440 1..440 2347 98.4 Plus

FI05907.hyp Sequence

Translation from 1589 to 2911

> FI05907.hyp
MKRDVSTSTIGRDEARRPLMEAYMFQRRVLLGCSLLMVVSLLIWIVAIST
DHWIIISGGKGIFIPESRRFFMSSHSGLWRHCRNTIVPNAMSNAQVVRNF
SSMSYTSQTNINEAKRNLSQMDFIKEFAHEKLETSDNFTESARRHMFAHW
VRGEDMEFQTLRHAFRTLVMNTEENQRQFNATAIKPIPINPLDVQGIIER
NTFGSALQRVKYNNTWSYYVIPEVAQLAIFRNWTDYPLVVRLLGTYIRDI
SIPAYVLNDERVILILVPPLPPKKGQPAYYSYIPNQRCKYIDMFPNSNAL
RNEPGFDDELLDYIRTQASFACITLFVMSLGAVFSFYTFMNPRYMFKRLA
GGIHLVAASTALVVLQVLFSSIDYTKEHLFYAYPEGAQLTYGYGVYLAWF
TFVDNILCGVMFLWYSGKKKGAKAPNDEVAMADEPTIMGR*

FI05907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-PB 440 CG4984-PB 1..440 1..440 2312 100 Plus
CG4984-PA 440 CG4984-PA 1..440 1..440 2312 100 Plus
CG4984-PD 447 CG4984-PD 1..447 1..440 2294 98.4 Plus
CG4984-PC 447 CG4984-PC 1..447 1..440 2294 98.4 Plus