Clone FI06001 Report

Search the DGRC for FI06001

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:60
Well:1
Vector:pOTB7
Associated Gene/TranscriptCG18130-RA
Protein status:FI06001.pep: gold
Sequenced Size:2363

Clone Sequence Records

FI06001.complete Sequence

2363 bp assembled on 2009-04-28

GenBank Submission: BT082078.1

> FI06001.complete
ATCCAATTGAAAAGGGAAAAAATAGGCATTCAAAATTCAGCAACAAAATC
CAAAACTCGTTTATTTTGTTAATTTTTTTTTTTTTGGAAGTAGGTAGGCT
AAATGGCAAAGAAGGGGGGACAACAACAACTGCAGGCTGACATCCAAACG
GACGAGGAGCTGGAGCGTTTCATGGAGCGACCAGGACTCTTGGTTTTGGA
TGTTTACTCGGAATGGTGTGGTCCTTGCCAGGGTATGGTCGGATCCTTGC
GTAAAATCAAACTGGATGTTGGTGGCGATAATCTGCATCTGGCCATTTGC
AAATCGGATACGATCACGGCCTTGAAACGATTCAATAAGAGAAGTGAGCC
CATCTGGCTTTTTGTGACGGGCGGCAGGGCCGTAAATCTTCTGTTCGGTT
CGGATGTGCCTAAGCTGGTGAGTCTGCTGGTCAAAGAGCTAGAGAAGACC
ATGCAAAAATCATCGCGTCCAGGCACCTACAGACTTGACGAACTGCAGCC
CATCGAGGTGGAGCAGCAGCGCATCAAAATGGAGGCCATCGAGCGGGCCG
AGCGGGCGGAGCGCGAGATAAAGCACAAGAAGCAGATAGACTACCTTAAC
CATGTAACGGACTCCATTATGGAGAATATGCCCGATATTGGAGTGACTGT
CTTTGGACCGCAAGTCAATCGTGATATGTTCAAGAAGCTAACCGAACCAG
CCGAAGCGCTCAAAATGCAGTGCAAGGATCGCCGGGTCATCCAGGTGAGC
ACCGATCAGTTCGAGATTGTGAACTTTGCATGCAAGAATCCCATGCCGCC
GGATGTGATCGAACAACTGGACGGCAAGGAGCTGCTCATGTGCTTCTGGA
AGATTGACGAAAGCATCGGCACAGTGCCCAACGTTCTAATGGCCTATGCC
CACGAGCTAACCAAGGAGCGAGTGGCACCACCCAACGATGATATACCCGA
GGAGCATGTTATACCGCCGCTAATCACAACTATGAAACTAAAAGTCGAGG
TGGAGCTGAAGGAGGGCGAGACTTGGGTGGAGGAGATAAGCTCCGAAGAG
GAGGCGAGGCTGCATCAGGCCAAAAGCAAGGCCAAAACCAAATCCATTAG
CCACGAGGAAGCGCATCTGGCCGAAGAGGAAGCAGCCGATCTGGATGCCG
AGGAGGAGGCCAGCGAGGAGGAGACAGTTATGCCAGAACCCGGCGGCGAT
GCAATGGGCGGGCTCCCATCAATGCCCGGCTTCGAACTGGAAATAGAACC
CGTCGATGAGGCCGGCGAGGATGAGGAGGAGGTGCAGGAGATCAAGGAGG
AGGAGCCATCGAAGCCACTCACTCGCACCAAGACGGTGAAAATGCCACCC
ATTTGGGTGCCCAACAGCCGGCGCACCCATGCCGCCCTCATCTATGTGTT
CTTCCGCGGTCAGACGTCTGGATTTCTGCCACCGGATCCCAAGCCGGAAC
CGCCGCATGTCATCATGGCGTTCGATGCCTCCAAGCGCAAGGAGATCATG
CATGTAATCGATCGACACAAGGACGATGTGCCGCTCTATGGATTCTTCTC
AAGCGCCGAACCGGATGAGGCCGAATTGATTGCCACCTCAACGGACAAGT
ACGAGAGCAGTCCGCACTCATCTGGCGACAAGATCGTGCTGAAGGTCAAC
AAGGTCCAGTCCAACATGATGTTATCCCTGGTCTCGTACGGTCCCAGCTA
TGTGAGTCCCAATGTAACTGTCGGCAAGGACGAGGCGCTCAAGTTCTTCC
CGGAGGACTACAAGCCCCAGGAGGAGGTCGTCGTCGAGGTCGAAAAGAAA
AAGAAGAAGAGCAAGCGGGCCACCGAAATCAATCAGGAAATGGAGGCAGC
GGCTGCAGCTGCAGCTGCAGCGGCGGCTCATCCTTCGGAGGCTCCTGCTC
CAGTCGAAGCAGAAGCTCACGCCGCAGAGGCTCCCGCTGCCGTGGAAGGA
GATGCCGCACCAGCGGCTGCCGAAGCACCGCCAGCCGGAGATGCCGCACC
GGTGGCGCCACCACCAGCTGAGCCAGCCGCCGAAGGAGCGGCGCCAGAGG
CACCGGCTCCAGCTCCAGCTCCAGCTCCAGCTCCGGAAGCCCCAGCAGCG
GAGGAGGCGCCACATGAGGCGCCCAAGGAGGAGGCACCTGCCGCCGAAGC
GCCACCGGAACCGGAGGCAGAAGCTCCTGCTCCTGCTCCTGCCGAGCCTG
CACCTGAGCCAGCAGCCGAGTAAACCAGTATAGCACTCATTATTACTCAT
TATTTGGCTACTAAATTTTTTAGTGTATACGCGAAAATTCCCAGTTGTTG
AAATGTTAAAATTTTAAATTTAATAAAAAACTGAAATAGCATTCAAAAAA
AAAAAAAAAAAAA

FI06001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-RA 2344 CG18130-RA 1..2344 1..2344 11690 99.9 Plus
CG18130-RB 1985 CG18130-RB 113..1985 472..2344 9335 99.8 Plus
CG18130-RB 1985 CG18130-RB 65..114 369..418 250 100 Plus
CG14221-RB 1943 CG14221-RB 750..825 785..860 170 81.5 Plus
CG14221-RB 1943 CG14221-RB 544..697 579..732 140 72.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11882064..11883317 1622..369 6255 99.9 Minus
chrX 22417052 chrX 11881205..11881741 2344..1808 2685 100 Minus
chrX 22417052 chrX 11883663..11883855 193..1 965 100 Minus
chrX 22417052 chrX 11881806..11881992 1809..1623 935 100 Minus
chrX 22417052 chrX 11883501..11883605 297..193 525 100 Minus
chrX 22417052 chrX 11883369..11883441 370..298 365 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-RA 2121 CG18130-PA 1..2121 103..2223 10590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-RA 2344 CG18130-RA 1..2344 1..2344 11690 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-PA 706 CG18130-PA 1..580 103..1842 2322 100 Plus
CG14221-PC 586 CG14221-PC 1..293 103..984 892 60.2 Plus
CG14221-PB 542 CG14221-PB 1..249 235..984 702 57.6 Plus
CG14221-PC 586 CG14221-PC 354..500 1324..1764 469 56.5 Plus
CG14221-PB 542 CG14221-PB 310..456 1324..1764 469 56.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11990977..11992230 1622..369 6255 99.9 Minus
X 23542271 X 11990116..11990654 2346..1808 2680 99.8 Minus
X 23542271 X 11992576..11992768 193..1 965 100 Minus
X 23542271 X 11990719..11990905 1809..1623 935 100 Minus
X 23542271 X 11992414..11992518 297..193 525 100 Minus
X 23542271 X 11992282..11992354 370..298 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11999075..12000328 1622..369 6255 99.9 Minus
X 23527363 X 11998214..11998752 2346..1808 2680 99.8 Minus
X 23527363 X 12000674..12000866 193..1 965 100 Minus
X 23527363 X 11998817..11999003 1809..1623 935 100 Minus
X 23527363 X 12000512..12000616 297..193 525 100 Minus
X 23527363 X 12000380..12000452 370..298 365 100 Minus
X 23527363 X 19628244..19628319 860..785 170 81.5 Minus
X 23527363 X 19628372..19628525 732..579 140 72.7 Minus
Blast to na_te.dros performed on 2014-11-27 08:41:42 has no hits.

FI06001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:14:04 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11883663..11883855 1..193 100   Minus
chrX 11883501..11883604 194..297 100 <- Minus
chrX 11883370..11883441 298..369 100 <- Minus
chrX 11882064..11883316 370..1622 99 <- Minus
chrX 11881806..11881992 1623..1809 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:10 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2121 103..2223 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:33 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2121 103..2223 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:47:07 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2121 103..2223 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:04 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2121 103..2223 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 17:10:09 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2340 1..2340 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:33 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2344 1..2344 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:47:07 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2344 1..2344 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:04 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 1..2344 1..2344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:14:04 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
X 11992576..11992768 1..193 100   Minus
X 11992414..11992517 194..297 100 <- Minus
X 11992283..11992354 298..369 100 <- Minus
X 11990977..11992229 370..1622 99 <- Minus
X 11990719..11990905 1623..1809 100 <- Minus
X 11990118..11990652 1810..2344 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:47:07 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11886609..11886801 1..193 100   Minus
arm_X 11886447..11886550 194..297 100 <- Minus
arm_X 11886316..11886387 298..369 100 <- Minus
arm_X 11885010..11886262 370..1622 99 <- Minus
arm_X 11884752..11884938 1623..1809 100 <- Minus
arm_X 11884151..11884685 1810..2344 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:22 Download gff for FI06001.complete
Subject Subject Range Query Range Percent Splice Strand
X 12000674..12000866 1..193 100   Minus
X 12000512..12000615 194..297 100 <- Minus
X 12000381..12000452 298..369 100 <- Minus
X 11999075..12000327 370..1622 99 <- Minus
X 11998817..11999003 1623..1809 100 <- Minus
X 11998216..11998750 1810..2344 99 <- Minus

FI06001.pep Sequence

Translation from 102 to 2222

> FI06001.pep
MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLR
KIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGS
DVPKLVSLLVKELEKTMQKSSRPGTYRLDELQPIEVEQQRIKMEAIERAE
RAEREIKHKKQIDYLNHVTDSIMENMPDIGVTVFGPQVNRDMFKKLTEPA
EALKMQCKDRRVIQVSTDQFEIVNFACKNPMPPDVIEQLDGKELLMCFWK
IDESIGTVPNVLMAYAHELTKERVAPPNDDIPEEHVIPPLITTMKLKVEV
ELKEGETWVEEISSEEEARLHQAKSKAKTKSISHEEAHLAEEEAADLDAE
EEASEEETVMPEPGGDAMGGLPSMPGFELEIEPVDEAGEDEEEVQEIKEE
EPSKPLTRTKTVKMPPIWVPNSRRTHAALIYVFFRGQTSGFLPPDPKPEP
PHVIMAFDASKRKEIMHVIDRHKDDVPLYGFFSSAEPDEAELIATSTDKY
ESSPHSSGDKIVLKVNKVQSNMMLSLVSYGPSYVSPNVTVGKDEALKFFP
EDYKPQEEVVVEVEKKKKKSKRATEINQEMEAAAAAAAAAAAHPSEAPAP
VEAEAHAAEAPAAVEGDAAPAAAEAPPAGDAAPVAPPPAEPAAEGAAPEA
PAPAPAPAPAPEAPAAEEAPHEAPKEEAPAAEAPPEPEAEAPAPAPAEPA
PEPAAE*

FI06001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19302-PA 683 GF19302-PA 1..572 1..575 2199 80.7 Plus
Dana\GF20278-PA 589 GF20278-PA 1..299 1..300 1034 60.3 Plus
Dana\GF20278-PA 589 GF20278-PA 357..503 408..554 442 57.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19570-PA 700 GG19570-PA 1..582 1..582 2601 90.9 Plus
Dere\GG18042-PA 582 GG18042-PA 1..299 1..300 1014 59.3 Plus
Dere\GG18042-PA 582 GG18042-PA 347..496 405..554 426 55.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11822-PA 667 GH11822-PA 1..667 1..672 1637 54.4 Plus
Dgri\GH12569-PA 563 GH12569-PA 1..306 1..307 1075 62.2 Plus
Dgri\GH12569-PA 563 GH12569-PA 277..476 351..554 499 48.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-PA 706 CG18130-PA 1..706 1..706 3647 100 Plus
CG14221-PC 586 CG14221-PC 1..585 1..625 1457 46.8 Plus
CG14221-PB 542 CG14221-PB 1..541 45..625 1267 44.7 Plus
CG3108-PA 1132 CG3108-PA 204..626 259..698 244 27.5 Plus
Tm1-PK 518 CG4898-PK 398..518 594..704 217 55.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14764-PA 694 GI14764-PA 1..557 1..564 1591 62.7 Plus
Dmoj\GI16349-PA 554 GI16349-PA 1..304 1..301 1065 62 Plus
Dmoj\GI16349-PA 554 GI16349-PA 277..554 351..628 438 41.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15842-PA 467 GL15842-PA 1..466 1..473 1528 69.3 Plus
Dper\GL27104-PA 645 GL27104-PA 137..405 47..316 766 52.2 Plus
Dper\GL27104-PA 645 GL27104-PA 426..590 396..558 434 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23461-PA 776 GA23461-PA 1..553 1..559 1956 69.8 Plus
Dpse\GA12835-PA 585 GA12835-PA 1..315 1..316 1042 58.5 Plus
Dpse\GA12835-PA 585 GA12835-PA 336..494 396..554 440 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13231-PA 700 GM13231-PA 1..580 1..580 2729 97.4 Plus
Dsec\GM22726-PA 577 GM22726-PA 1..299 1..300 1017 59.3 Plus
Dsec\GM22726-PA 577 GM22726-PA 345..491 408..554 431 56.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15949-PA 697 GD15949-PA 1..580 1..580 2732 97.4 Plus
Dsim\GD24456-PA 590 GD24456-PA 1..299 1..300 1015 59 Plus
Dsim\GD24456-PA 590 GD24456-PA 358..504 408..554 438 57.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18734-PA 685 GJ18734-PA 1..658 1..678 1765 56 Plus
Dvir\GJ15687-PA 505 GJ15687-PA 1..303 1..304 1084 62.8 Plus
Dvir\GJ15687-PA 505 GJ15687-PA 277..472 351..558 507 49 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24984-PA 748 GK24984-PA 1..643 1..621 2025 63.1 Plus
Dwil\GK25405-PA 587 GK25405-PA 1..505 1..554 1462 52.3 Plus
Dwil\GK24910-PA 588 GK24910-PA 1..506 1..554 1455 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16730-PA 695 GE16730-PA 1..582 1..582 2532 91.1 Plus
Dyak\GE17371-PA 587 GE17371-PA 1..299 1..300 1020 59.7 Plus
Dyak\GE17371-PA 587 GE17371-PA 353..502 405..554 426 54 Plus

FI06001.hyp Sequence

Translation from 102 to 2222

> FI06001.hyp
MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLR
KIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGS
DVPKLVSLLVKELEKTMQKSSRPGTYRLDELQPIEVEQQRIKMEAIERAE
RAEREIKHKKQIDYLNHVTDSIMENMPDIGVTVFGPQVNRDMFKKLTEPA
EALKMQCKDRRVIQVSTDQFEIVNFACKNPMPPDVIEQLDGKELLMCFWK
IDESIGTVPNVLMAYAHELTKERVAPPNDDIPEEHVIPPLITTMKLKVEV
ELKEGETWVEEISSEEEARLHQAKSKAKTKSISHEEAHLAEEEAADLDAE
EEASEEETVMPEPGGDAMGGLPSMPGFELEIEPVDEAGEDEEEVQEIKEE
EPSKPLTRTKTVKMPPIWVPNSRRTHAALIYVFFRGQTSGFLPPDPKPEP
PHVIMAFDASKRKEIMHVIDRHKDDVPLYGFFSSAEPDEAELIATSTDKY
ESSPHSSGDKIVLKVNKVQSNMMLSLVSYGPSYVSPNVTVGKDEALKFFP
EDYKPQEEVVVEVEKKKKKSKRATEINQEMEAAAAAAAAAAAHPSEAPAP
VEAEAHAAEAPAAVEGDAAPAAAEAPPAGDAAPVAPPPAEPAAEGAAPEA
PAPAPAPAPAPEAPAAEEAPHEAPKEEAPAAEAPPEPEAEAPAPAPAEPA
PEPAAE*

FI06001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-PA 706 CG18130-PA 1..706 1..706 3647 100 Plus
CG14221-PC 586 CG14221-PC 1..585 1..625 1457 46.8 Plus
CG14221-PB 542 CG14221-PB 1..541 45..625 1267 44.7 Plus
CG3108-PA 1132 CG3108-PA 204..626 259..698 244 27.5 Plus
Tm1-PK 518 CG4898-PK 398..518 594..704 217 55.3 Plus