Clone FI06015 Report

Search the DGRC for FI06015

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:60
Well:15
Vector:pOTB7
Associated Gene/Transcriptr-cup-RA
Protein status:FI06015.pep: gold
Sequenced Size:2158

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
r-cup 2008-12-18 5.12 accounting

Clone Sequence Records

FI06015.complete Sequence

2158 bp assembled on 2008-10-27

GenBank Submission: BT050477.1

> FI06015.complete
TTCGATTTCGTTTTTTTGTAGCATTTATTTTTTAGGGTGTTTCCTGAATT
TATTTTTATTTTTTTTTACTTGAGCGACAAGGAGACGTTGGTGCAGAATG
AAGGACTCGAGTCAATCGGCGCCGGCAGGCCTTTTGGTGGCAAATCTGAA
GTCTTGGGAAACGTTCGACTGGCCGACGGAGCAGCAGCGTTGGATCTACC
GCAGTTGGGGTCAGTACTTTGCGCGGATGCGGAAGAACACCTTTGCCCAG
AAGTACTTCGACAAATGCATCACAGAGAATGAGAGCACGGATCACAAGGC
TCTTTATCTGCGCAGCAAATTCAAGAGATCGGTGGCCCTGACGCAGGACG
CATTGGAGGATAGTTTGAGGGCCATGGAGGTAAGGCAGGCGTGGGACGCA
AATGTGTCCATGGAGCTCGGAGATGCGCTCTACGATTTGAATCGGTTTGA
GGAGAACAAGAGCCTGCTGCACGACAATGTCCGTCGGCATGCGGGCACCG
CTCTAAAGAGCTTCGAGAATCGCCTCGTGGTAGTCGATGAGAATCTCAAG
GATTGCACGGGCTTCAGCCTGGCCAACTTCTTCATGGAGCATTCCGCGCA
GCTGCCCGGCTTCTATGCCCATCAGCAGGAGGAGCTTCGAAGGGCCGACA
GGCGGCCGCTGTGGAAAATCCTCAAGGAGCGAAAGGAGTGTGATGTCCAG
AGCAGGATCGATCGCAAGGAGGTGATGCTCTCCCCACTGGAAAGAGAGCG
CAGGCGTCGCAAGACCAAGATATTTTATCAGAACTATTTGGGTCGCAGCT
GGACCGATTTTTTCTTTCTGAAAACACTTCGCCGGCATCCCAACTGTCTT
CTAGACAATCATTTCGGCTCCTCGGCGGACCGCACCAAGTATCTTGAGTA
TGCGTTCCAGCGCCTTAAGACCTTCACACGGATGCTCCAGGCAAGGAGAC
CCATGTACAAGGAGTACTTCCATCGGAATCCCCAGATAGAGGCTCGCATG
CGGGATGCGAACTTGTTCCGGATCCAGTACCAAACCAGGCGAAACATGGT
GAGCATCCTGCGGACCATTAAGGTGCTGCGGGGGCGGAATGATATCAAGC
GCCTGCGCAAGTTTGTGGAGGAAGTGATGGGCAGCTACGTGGTCATCAAG
ACGAATCGACTGATGCCCTGGAAGGCGGAGTTCATGAACGAGGTGTACAA
CAATCTGGCCCTCAGTTTGTGCGAGGGATACCGCCTGCCGCCCACACGGG
TCACGCCCTACGACAAGAGCGCCATGTGCCAGCTGCTCAACATACCGGTG
GCCAAGCCGCTGGAGCACACGGAGCTCATCTTCGGGGATCGATCCACCTA
CTCCTATGCCGGCGCCGACAAACAGAGCACCGATCGATTGGCAGACCAAA
ACCAAATCGAGTATCTGGAGAAACGACTTCTCTTCGCCCGCCTGCCGATC
GAAAGGAGCTACTTGCTCCATGAGCTGGCCGATCGGCATATGCAGAAGAA
CCACTTTGTGCAGAGCCTGTCCTACGCCCAGAAGGCCATCGAGGAGGCCA
GGGTATGCAATAGCCTGATCTGGGAGTTTCTTAGCACCATGCTGATGGCC
AAGTCACACGCGGTGCTCCACAAGTACGAGCGCCAAACGGAGGTGCTCAA
CTCCGCCTACGAACTGGCCGCCCAGCTCAAGTCGCCCCAACTGTGCACCT
TCATCGAACTGTGCCGCATGCTCAACAAGGACTACATCACGTTGCGCAAG
ATGTCCCAACTGGTGACCACCAAACGGCTGCGCACCAAAATCTCCAACAG
GTCCAGTTTCCTCAGCTCACCCAACTGTTCGCCCAACTTCTCGGAATTCA
AAAAGGAAGAGTATGGTCATTTGGCCGCCTAAGTCGGCGGATTGGATGGA
AGGCAGTGCACATAGGCAGTGCCTTCTATTCGAACTGTTGCCTTTGGTCG
GGCCAAGTGTCAGCCACAAAATCCGCTAAAACAAATCGAGTTCCTATCAG
ATATCGTTAAAGTACAAGTTCAGAGCCAGATGTCTGTAGCATTTAAAGTA
TGTCTTTACACGTAATGTAACTAAATCGTACAAATGCACTGAGAAAAAAA
ACAACCAAAATCCTATAAATATATCTAAAGTTAAGCGTAAAAAAAAAAAA
AAAAAAAA

FI06015.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-RA 2461 r-cup-RA 238..2378 1..2139 10475 99.5 Plus
r-cup.a 2409 r-cup.a 1..2141 1..2139 10475 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20889946..20891045 1099..1 5310 99.5 Minus
chrX 22417052 chrX 20888547..20889287 2138..1399 3625 99.6 Minus
chrX 22417052 chrX 20889557..20889857 1398..1098 1505 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-RA 1785 CG10998-PA 1..1785 98..1882 8850 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-RA 2140 CG10998-RA 1..2140 1..2138 10430 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-PA 594 CG10998-PA 1..594 98..1879 3102 100 Plus
CG7634-PA 579 CG7634-PA 24..563 155..1777 1025 40.1 Plus
CG15128-PA 580 CG15128-PA 8..558 122..1780 959 38.9 Plus
wa-cup-PB 580 CG10113-PB 13..549 119..1753 842 36.1 Plus
p-cup-PA 538 CG12993-PA 44..529 368..1819 623 32.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21024789..21025888 1099..1 5310 99.5 Minus
X 23542271 X 21023389..21024130 2139..1399 3630 99.6 Minus
X 23542271 X 21024400..21024700 1398..1098 1505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21009881..21010980 1099..1 5340 99.4 Minus
X 23527363 X 21008481..21009222 2139..1399 3640 99.5 Minus
X 23527363 X 21009492..21009792 1398..1098 1505 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:04:17 has no hits.

FI06015.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:15:09 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20889946..20891045 1..1099 97   Minus
chrX 20889557..20889855 1100..1398 100 <- Minus
chrX 20888547..20889287 1399..2138 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:50 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..1785 98..1882 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:00 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..1785 98..1882 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:45:11 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..1785 98..1882 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:09 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..1785 98..1882 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:56:44 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..2140 1..2138 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:00 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..2140 1..2138 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:45:11 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..2140 1..2138 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 09:48:49 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..2140 1..2138 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:09 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 1..2140 1..2138 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:15:09 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
X 21024789..21025888 1..1099 99   Minus
X 21024400..21024698 1100..1398 100 <- Minus
X 21023390..21024130 1399..2138 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:45:11 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20895816..20896915 1..1099 99   Minus
arm_X 20895427..20895725 1100..1398 100 <- Minus
arm_X 20894417..20895157 1399..2138 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:02 Download gff for FI06015.complete
Subject Subject Range Query Range Percent Splice Strand
X 21009881..21010980 1..1099 99   Minus
X 21009492..21009790 1100..1398 100 <- Minus
X 21008482..21009222 1399..2138 99 <- Minus

FI06015.pep Sequence

Translation from 97 to 1881

> FI06015.pep
MKDSSQSAPAGLLVANLKSWETFDWPTEQQRWIYRSWGQYFARMRKNTFA
QKYFDKCITENESTDHKALYLRSKFKRSVALTQDALEDSLRAMEVRQAWD
ANVSMELGDALYDLNRFEENKSLLHDNVRRHAGTALKSFENRLVVVDENL
KDCTGFSLANFFMEHSAQLPGFYAHQQEELRRADRRPLWKILKERKECDV
QSRIDRKEVMLSPLERERRRRKTKIFYQNYLGRSWTDFFFLKTLRRHPNC
LLDNHFGSSADRTKYLEYAFQRLKTFTRMLQARRPMYKEYFHRNPQIEAR
MRDANLFRIQYQTRRNMVSILRTIKVLRGRNDIKRLRKFVEEVMGSYVVI
KTNRLMPWKAEFMNEVYNNLALSLCEGYRLPPTRVTPYDKSAMCQLLNIP
VAKPLEHTELIFGDRSTYSYAGADKQSTDRLADQNQIEYLEKRLLFARLP
IERSYLLHELADRHMQKNHFVQSLSYAQKAIEEARVCNSLIWEFLSTMLM
AKSHAVLHKYERQTEVLNSAYELAAQLKSPQLCTFIELCRMLNKDYITLR
KMSQLVTTKRLRTKISNRSSFLSSPNCSPNFSEFKKEEYGHLAA*

FI06015.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21861-PA 590 GF21861-PA 4..580 3..580 2271 71.8 Plus
Dana\GF23726-PA 587 GF23726-PA 8..572 8..569 1045 39.9 Plus
Dana\GF13170-PA 591 GF13170-PA 7..550 8..550 1013 40.7 Plus
Dana\GF17676-PA 561 GF17676-PA 6..506 7..552 736 33.5 Plus
Dana\GF22339-PA 640 GF22339-PA 12..598 10..552 675 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17563-PA 594 GG17563-PA 1..594 1..594 2838 88.7 Plus
Dere\GG16202-PA 579 GG16202-PA 6..563 9..560 1018 39.8 Plus
Dere\GG20893-PA 580 GG20893-PA 8..558 9..561 949 38.3 Plus
Dere\GG14085-PA 580 GG14085-PA 13..549 8..552 839 36 Plus
Dere\GG18182-PA 538 GG18182-PA 62..515 109..560 620 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17765-PA 382 GH17765-PA 5..362 210..571 990 54 Plus
Dgri\GH22765-PA 581 GH22765-PA 10..567 9..570 971 38.5 Plus
Dgri\GH22763-PA 576 GH22763-PA 6..557 7..560 954 37.8 Plus
Dgri\GH18307-PA 572 GH18307-PA 2..556 1..564 845 35.2 Plus
Dgri\GH24905-PA 617 GH24905-PA 18..574 8..543 632 32.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-PA 594 CG10998-PA 1..594 1..594 3102 100 Plus
CG7634-PA 579 CG7634-PA 24..563 20..560 1025 40.1 Plus
CG15128-PA 580 CG15128-PA 8..558 9..561 959 38.9 Plus
wa-cup-PB 580 CG10113-PB 13..549 8..552 842 36.1 Plus
p-cup-PA 538 CG12993-PA 44..529 91..574 623 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15098-PA 577 GI15098-PA 19..570 20..570 1398 50.1 Plus
Dmoj\GI11337-PA 569 GI11337-PA 17..554 15..552 1056 41.4 Plus
Dmoj\GI18542-PA 573 GI18542-PA 9..556 9..559 967 38.6 Plus
Dmoj\GI18541-PA 465 GI18541-PA 1..431 69..539 749 36.3 Plus
Dmoj\GI24120-PA 579 GI24120-PA 6..533 7..550 682 31.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15914-PA 624 GL15914-PA 14..579 7..578 1917 63.1 Plus
Dper\GL24992-PA 587 GL24992-PA 10..577 9..575 1066 39.5 Plus
Dper\GL22231-PA 577 GL22231-PA 7..552 7..551 1063 41.1 Plus
Dper\GL14902-PA 594 GL14902-PA 10..563 9..551 990 39 Plus
Dper\GL11726-PA 579 GL11726-PA 6..568 7..570 965 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10698-PA 624 GA10698-PA 10..579 3..578 1922 62.8 Plus
Dpse\GA27427-PA 577 GA27427-PA 7..552 7..551 1051 40.5 Plus
Dpse\GA25385-PA 594 GA25385-PA 10..563 9..551 986 39 Plus
Dpse\GA13516-PA 579 GA13516-PA 6..568 7..570 969 36.9 Plus
Dpse\GA10082-PA 565 GA10082-PA 10..547 8..553 886 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\r-cup-PA 594 GM22647-PA 1..594 1..594 3085 97.1 Plus
Dsec\GM10962-PA 580 GM10962-PA 13..557 8..560 860 36.7 Plus
Dsec\GM19817-PA 454 GM19817-PA 1..433 124..561 783 39.6 Plus
Dsec\GM22384-PA 503 GM22384-PA 6..487 9..560 734 33.7 Plus
Dsec\GM13314-PA 538 GM13314-PA 54..515 101..560 597 33.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\r-cup-PA 595 GD19350-PA 1..595 1..594 3066 96.8 Plus
Dsim\GD14973-PA 579 GD14973-PA 6..563 9..560 1035 40.5 Plus
Dsim\GD25309-PA 579 GD25309-PA 8..558 9..561 971 39.2 Plus
Dsim\GD19937-PA 580 GD19937-PA 13..557 8..560 852 36.5 Plus
Dsim\GD17357-PA 538 GD17357-PA 29..515 79..560 604 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11593-PA 566 GJ11593-PA 8..566 7..571 1036 39.3 Plus
Dvir\GJ21411-PA 583 GJ21411-PA 8..555 8..559 948 38 Plus
Dvir\GJ10942-PA 562 GJ10942-PA 9..541 8..551 836 35.7 Plus
Dvir\GJ21410-PA 836 GJ21410-PA 323..807 55..539 830 38.1 Plus
Dvir\GJ18908-PA 257 GJ18908-PA 3..241 334..572 752 59.8 Plus
Dvir\GJ21410-PA 836 GJ21410-PA 7..329 17..336 523 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15695-PA 573 GK15695-PA 19..573 20..581 1080 41.1 Plus
Dwil\GK20327-PA 580 GK20327-PA 9..578 8..576 1076 42.6 Plus
Dwil\GK12012-PA 571 GK12012-PA 10..559 13..566 922 37.9 Plus
Dwil\GK20040-PA 430 GK20040-PA 10..270 9..262 785 58.6 Plus
Dwil\GK19955-PA 648 GK19955-PA 7..590 4..552 681 32.4 Plus
Dwil\GK20040-PA 430 GK20040-PA 275..403 437..565 557 80.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15324-PA 591 GE15324-PA 1..591 1..590 2859 90 Plus
Dyak\GE19772-PA 579 GE19772-PA 6..563 9..560 1021 40 Plus
Dyak\GE23266-PA 579 GE23266-PA 6..563 9..560 1016 39.9 Plus
Dyak\GE13833-PA 580 GE13833-PA 8..558 9..561 955 38.6 Plus
Dyak\GE24930-PA 540 GE24930-PA 13..517 8..560 748 33.5 Plus

FI06015.hyp Sequence

Translation from 97 to 1881

> FI06015.hyp
MKDSSQSAPAGLLVANLKSWETFDWPTEQQRWIYRSWGQYFARMRKNTFA
QKYFDKCITENESTDHKALYLRSKFKRSVALTQDALEDSLRAMEVRQAWD
ANVSMELGDALYDLNRFEENKSLLHDNVRRHAGTALKSFENRLVVVDENL
KDCTGFSLANFFMEHSAQLPGFYAHQQEELRRADRRPLWKILKERKECDV
QSRIDRKEVMLSPLERERRRRKTKIFYQNYLGRSWTDFFFLKTLRRHPNC
LLDNHFGSSADRTKYLEYAFQRLKTFTRMLQARRPMYKEYFHRNPQIEAR
MRDANLFRIQYQTRRNMVSILRTIKVLRGRNDIKRLRKFVEEVMGSYVVI
KTNRLMPWKAEFMNEVYNNLALSLCEGYRLPPTRVTPYDKSAMCQLLNIP
VAKPLEHTELIFGDRSTYSYAGADKQSTDRLADQNQIEYLEKRLLFARLP
IERSYLLHELADRHMQKNHFVQSLSYAQKAIEEARVCNSLIWEFLSTMLM
AKSHAVLHKYERQTEVLNSAYELAAQLKSPQLCTFIELCRMLNKDYITLR
KMSQLVTTKRLRTKISNRSSFLSSPNCSPNFSEFKKEEYGHLAA*

FI06015.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-PA 594 CG10998-PA 1..594 1..594 3102 100 Plus
CG7634-PA 579 CG7634-PA 24..563 20..560 1025 40.1 Plus
CG15128-PA 580 CG15128-PA 8..558 9..561 959 38.9 Plus
wa-cup-PB 580 CG10113-PB 13..549 8..552 842 36.1 Plus
p-cup-PA 538 CG12993-PA 44..529 91..574 623 32.4 Plus