Clone FI06052 Report

Search the DGRC for FI06052

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:60
Well:52
Vector:pOTB7
Associated Gene/Transcriptalpha-Est6-RA
Protein status:FI06052.pep: gold
Sequenced Size:1867

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
alpha-Est6 2008-12-18 5.12 accounting

Clone Sequence Records

FI06052.complete Sequence

1867 bp assembled on 2008-09-12

GenBank Submission: BT044260.1

> FI06052.complete
CTTTTTGTTTGGATCGAGTGTACTTTATTATTTGGGTCAAAAATAGTATT
TGACTATGACATGTGGAAACTCTGTCAGCCGAGAAGTCGAAGTCGGATCA
AATGTTTCAGATTCCTAATCCTGCGTTGTTGTCCCGGATTCAAGAGATTC
TCGTGCCAATCAGCAGGTGATGCAGACTCCAAAGTCGTCAAGCTATCAGT
AGGGAGTGTCAAGGGTCGTCGACTGAGCGGTATCTATGGTGACGAGTTCT
ACAGCTTCGAGGGAATTCCCTTTGCCAAGCCGCCGCTAGGGAAAGCCCGA
TTTGTGGCCTCCCAATTGGCAGACCCATGGAATTCAGAGCTCGATGCTCG
GCAGGAGAGACCGATTCCTCTGCAGATGGACAGAAGGTCGGGAAAGGTCG
TTGGCAGTGAGGATTGCCTGTACTTAAACGTATACACCAAGCATTTTAAC
GAATCTGAGCCACCTCTGCCCGTAATGGTGTATATCTACGGCGGTGCCTT
TCGCACAGGCGGAGCTGTGAAGAGCAAATACGGGCCGGATTACTTGATGA
GCAGGGATGTTGTATATGTGCTATTCAACTATCGCCTCTGCTCCCTGGGA
TTCCTTAGTATGCCCAGTGGCAAGTTGGATGTGCCGGGCAATGCGGGTCT
CCATGATCAGTTACTAGCCCTTCAATGGGTTAGCCAGCACATACGGAACT
TCAACGGAGATCCGCAGAATATAACGCTTTTTGGCGAAAGTGCGGGGGCC
GCCTCGGTGCACTTTATGATGTGTCTGCCGCAGGCGAAGGGTCTCTTCCA
CAAGGCCATCATGATGTCCGGATCGATGCTGAGTCCCTGGGTGAATGCTC
CCGATAGCGATGGTATATTCTGCCGCCTGGCCACGTCTGCAGGATACGAA
GGACCCGCGGAAGAGGTCCCCATTTTGGAGTTTCTGCGCAACGTGAATGC
CGAAAAACTCATCGGCCACGATTTCATCTCACCCCGTGACCGTTGCTTTG
GGTTTCTTAACCCATTTGCTCCAGTTGTTGGAGGCCTGGTTGCAGCCCCG
TTTCAGCAGCTGATGAAGGAGGCGTGGTCCTGTGAAGTGCCCCTCCTCTT
GGGTGGCACTTCCTTCGAGGGACTGGTGTACTACCCATTCTGTCAGCTGG
ATAATGGCTATATGCTGGAGCTGCTGAAACATGAACCAGCGATGGTATTA
CCCCACGAGCTATATCAGTCGATGAGCGTCGAGGAGCGGAACACAGCGGC
CGATGTCCTCGTTAAGTATCACTATGGACCGCGCGGTATCACCAAGAGTA
ACATCACACAGATTCTAGATCTTTTCAGTTACAAGTTATTCTGGCACGGC
ATACATAGGGTGGTCCTCTCCAGATTATCTCACGCACAAGCACCTACCTA
TCTGTACCGGTTCGACTTCGATTCGCCCAAGTTGAATCTGATGAGGAACC
AGCTCTGCGGCGATGACATCAAACGCGGTGTTTGTCATGCGGATGACTTG
GGCTACATTTTCCACAAGCAGGCCCAAGCGAAGCAGCCCCTTGACTCCCC
GGAGTTCCTGACCATCCAGCGTATGGTGGGCATATTGACCACGTTTGCCA
GGACCGGCGATCCCAATTGTCCGGAGACGGGTCCGGATCCGTGGATGCCC
GTCTCCACAAAGTCTCCCTTCAAGGCATTGAATATTGGACAGCAGGTGGA
GTGTGTAACGCAGGTCGAAAAGGACGGTCTGAAGGTGTGGAATCGGCTAT
ATAGTGACTTAAAATAGTTGGGGGTTATATGAAGTCTATTTTGCTATAAT
TTTTGTAAATATTCAATAAACGATACTGTTTAGAGGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

FI06052.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-RA 1904 alpha-Est6-RA 65..1902 1..1838 9175 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3351251..3352126 1320..445 4365 99.9 Minus
chr3R 27901430 chr3R 3350643..3351165 1836..1314 2585 99.6 Minus
chr3R 27901430 chr3R 3354410..3354853 444..1 2220 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-RA 1707 CG1108-PA 1..1707 61..1767 8520 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-RA 1836 CG1108-RA 1..1836 1..1836 9165 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-PA 568 CG1108-PA 1..568 61..1764 2976 100 Plus
alpha-Est5-PA 542 CG1089-PA 23..536 217..1752 1209 47.1 Plus
alpha-Est5-PB 543 CG1089-PB 24..537 217..1752 1209 47.1 Plus
alpha-Est1-PA 565 CG1031-PA 50..559 232..1752 1084 44.9 Plus
alpha-Est2-PB 566 CG2505-PB 54..560 241..1752 1076 44.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7525175..7526050 1320..445 4380 100 Minus
3R 32079331 3R 7524565..7525089 1838..1314 2580 99.4 Minus
3R 32079331 3R 7528334..7528777 444..1 2220 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7266006..7266881 1320..445 4380 100 Minus
3R 31820162 3R 7265396..7265920 1838..1314 2580 99.4 Minus
3R 31820162 3R 7269165..7269608 444..1 2220 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:27:46 has no hits.

FI06052.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:17:55 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3354410..3354853 1..444 100   Minus
chr3R 3351251..3352126 445..1320 99 <- Minus
chr3R 3350643..3351158 1321..1836 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:15 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1707 61..1767 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:59 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1707 61..1767 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:40 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1707 61..1767 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:17:55 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1707 61..1767 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:11 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1836 1..1836 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:59 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1836 1..1836 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:40 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1836 1..1836 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 15:54:43 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1836 1..1836 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:17:55 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 1..1836 1..1836 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:17:55 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7528334..7528777 1..444 100   Minus
3R 7525175..7526050 445..1320 100 <- Minus
3R 7524567..7525082 1321..1836 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:40 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3354056..3354499 1..444 100   Minus
arm_3R 3350897..3351772 445..1320 100 <- Minus
arm_3R 3350289..3350804 1321..1836 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:28:12 Download gff for FI06052.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7269165..7269608 1..444 100   Minus
3R 7266006..7266881 445..1320 100 <- Minus
3R 7265398..7265913 1321..1836 99 <- Minus

FI06052.pep Sequence

Translation from 0 to 1766

> FI06052.pep
LFVWIECTLLFGSKIVFDYDMWKLCQPRSRSRIKCFRFLILRCCPGFKRF
SCQSAGDADSKVVKLSVGSVKGRRLSGIYGDEFYSFEGIPFAKPPLGKAR
FVASQLADPWNSELDARQERPIPLQMDRRSGKVVGSEDCLYLNVYTKHFN
ESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYLMSRDVVYVLFNYRLCSLG
FLSMPSGKLDVPGNAGLHDQLLALQWVSQHIRNFNGDPQNITLFGESAGA
ASVHFMMCLPQAKGLFHKAIMMSGSMLSPWVNAPDSDGIFCRLATSAGYE
GPAEEVPILEFLRNVNAEKLIGHDFISPRDRCFGFLNPFAPVVGGLVAAP
FQQLMKEAWSCEVPLLLGGTSFEGLVYYPFCQLDNGYMLELLKHEPAMVL
PHELYQSMSVEERNTAADVLVKYHYGPRGITKSNITQILDLFSYKLFWHG
IHRVVLSRLSHAQAPTYLYRFDFDSPKLNLMRNQLCGDDIKRGVCHADDL
GYIFHKQAQAKQPLDSPEFLTIQRMVGILTTFARTGDPNCPETGPDPWMP
VSTKSPFKALNIGQQVECVTQVEKDGLKVWNRLYSDLK*

FI06052.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17297-PA 574 GF17297-PA 1..569 21..585 2307 74.8 Plus
Dana\GF17295-PA 540 GF17295-PA 10..534 63..584 1261 46.5 Plus
Dana\GF17291-PA 565 GF17291-PA 28..559 56..584 1107 43.8 Plus
Dana\GF17678-PA 566 GF17678-PA 30..560 58..584 1102 43 Plus
Dana\GF17292-PA 555 GF17292-PA 12..551 54..583 1093 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25116-PA 568 GG25116-PA 1..568 21..588 2829 92.1 Plus
Dere\GG25094-PA 1065 GG25094-PA 535..1059 63..584 1221 46 Plus
Dere\GG25094-PA 1065 GG25094-PA 12..515 63..569 1131 45.2 Plus
Dere\GG25062-PA 565 GG25062-PA 28..559 56..584 1118 44.2 Plus
Dere\GG14130-PA 566 GG14130-PA 34..560 62..584 1116 44.4 Plus
Dere\GG25183-PA 563 GG25183-PA 19..559 49..585 1080 42.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19268-PA 570 GH19268-PA 26..562 58..586 1716 58.8 Plus
Dgri\GH19267-PA 541 GH19267-PA 10..535 63..584 1216 45.5 Plus
Dgri\GH19276-PA 562 GH19276-PA 32..558 62..585 1076 42.9 Plus
Dgri\GH18313-PA 564 GH18313-PA 28..562 56..588 1060 43.3 Plus
Dgri\GH20471-PA 566 GH20471-PA 32..561 60..585 1040 42.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-PA 568 CG1108-PA 1..568 21..588 3048 100 Plus
alpha-Est5-PA 542 CG1089-PA 14..536 65..584 1228 46.8 Plus
alpha-Est5-PB 543 CG1089-PB 15..537 65..584 1228 46.8 Plus
alpha-Est1-PA 565 CG1031-PA 28..559 56..584 1112 44.5 Plus
alpha-Est2-PB 566 CG2505-PB 34..560 62..584 1090 43.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23477-PA 572 GI23477-PA 2..566 33..588 1705 56.2 Plus
Dmoj\GI23476-PA 540 GI23476-PA 10..534 63..584 1231 46.2 Plus
Dmoj\GI24124-PA 566 GI24124-PA 34..560 62..584 1127 44.4 Plus
Dmoj\GI24123-PA 564 GI24123-PA 32..562 60..588 1099 44.3 Plus
Dmoj\GI21011-PA 566 GI21011-PA 32..561 60..585 1080 43.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12169-PA 538 GL12169-PA 31..531 58..586 1785 63 Plus
Dper\GL12167-PA 509 GL12167-PA 2..503 84..584 1161 44.9 Plus
Dper\GL12447-PA 566 GL12447-PA 31..561 59..585 1116 43.1 Plus
Dper\GL12163-PA 567 GL12163-PA 32..559 60..584 1096 43.4 Plus
Dper\GL12177-PA 563 GL12177-PA 19..559 49..585 1091 42.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10746-PA 575 GA10746-PA 31..568 58..586 2010 68.6 Plus
Dpse\GA26214-PA 538 GA26214-PA 5..532 58..584 1213 44.6 Plus
Dpse\GA15379-PA 566 GA15379-PA 31..561 59..585 1113 43.1 Plus
Dpse\GA10907-PA 563 GA10907-PA 19..559 49..585 1098 42.5 Plus
Dpse\GA26212-PA 567 GA26212-PA 32..559 60..584 1096 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10473-PA 568 GM10473-PA 1..568 21..588 2945 96.3 Plus
Dsec\GM10471-PA 540 GM10471-PA 10..534 63..584 1246 46.9 Plus
Dsec\GM10467-PA 565 GM10467-PA 28..559 56..584 1119 45 Plus
Dsec\GM10966-PA 566 GM10966-PA 34..560 62..584 1114 44.1 Plus
Dsec\GM10481-PA 563 GM10481-PA 19..559 49..585 1082 42.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\alpha-Est6-PA 568 GD19474-PA 1..568 21..588 2959 96.8 Plus
Dsim\GD19472-PA 540 GD19472-PA 10..534 63..584 1248 46.9 Plus
Dsim\GD19469-PA 565 GD19469-PA 28..559 56..584 1136 45.4 Plus
Dsim\GD19941-PA 566 GD19941-PA 34..560 62..584 1120 44.3 Plus
Dsim\GD19481-PA 563 GD19481-PA 19..562 49..588 1080 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10230-PA 1086 GJ10230-PA 545..1081 59..588 1737 59.8 Plus
Dvir\GJ10230-PA 1086 GJ10230-PA 1..522 67..579 1333 50.4 Plus
Dvir\GJ10229-PA 540 GJ10229-PA 10..534 63..584 1263 47 Plus
Dvir\GJ10236-PA 578 GJ10236-PA 48..577 62..588 1104 43.2 Plus
Dvir\GJ10947-PA 566 GJ10947-PA 34..560 62..584 1087 43 Plus
Dvir\GJ10234-PA 587 GJ10234-PA 29..582 58..586 1072 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11076-PA 575 GK11076-PA 29..570 47..588 1902 63.3 Plus
Dwil\GK11073-PA 521 GK11073-PA 6..515 78..584 1221 46.8 Plus
Dwil\GK11072-PA 539 GK11072-PA 10..533 63..584 1194 44 Plus
Dwil\GK11071-PA 540 GK11071-PA 10..534 63..584 1189 45 Plus
Dwil\GK12015-PA 566 GK12015-PA 32..560 60..584 1135 44.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25783-PA 568 GE25783-PA 1..568 21..588 2820 91.7 Plus
Dyak\GE24932-PA 540 GE24932-PA 10..534 63..584 1236 46.8 Plus
Dyak\GE25781-PA 940 GE25781-PA 410..935 63..585 1209 45.4 Plus
Dyak\GE11113-PA 565 GE11113-PA 28..559 56..584 1116 45.2 Plus
Dyak\GE11183-PA 566 GE11183-PA 40..560 68..584 1093 43.7 Plus
Dyak\GE25781-PA 940 GE25781-PA 6..448 57..519 639 34.2 Plus

FI06052.hyp Sequence

Translation from 0 to 1766

> FI06052.hyp
LFVWIECTLLFGSKIVFDYDMWKLCQPRSRSRIKCFRFLILRCCPGFKRF
SCQSAGDADSKVVKLSVGSVKGRRLSGIYGDEFYSFEGIPFAKPPLGKAR
FVASQLADPWNSELDARQERPIPLQMDRRSGKVVGSEDCLYLNVYTKHFN
ESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYLMSRDVVYVLFNYRLCSLG
FLSMPSGKLDVPGNAGLHDQLLALQWVSQHIRNFNGDPQNITLFGESAGA
ASVHFMMCLPQAKGLFHKAIMMSGSMLSPWVNAPDSDGIFCRLATSAGYE
GPAEEVPILEFLRNVNAEKLIGHDFISPRDRCFGFLNPFAPVVGGLVAAP
FQQLMKEAWSCEVPLLLGGTSFEGLVYYPFCQLDNGYMLELLKHEPAMVL
PHELYQSMSVEERNTAADVLVKYHYGPRGITKSNITQILDLFSYKLFWHG
IHRVVLSRLSHAQAPTYLYRFDFDSPKLNLMRNQLCGDDIKRGVCHADDL
GYIFHKQAQAKQPLDSPEFLTIQRMVGILTTFARTGDPNCPETGPDPWMP
VSTKSPFKALNIGQQVECVTQVEKDGLKVWNRLYSDLK*

FI06052.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-PA 568 CG1108-PA 1..568 21..588 3048 100 Plus
alpha-Est5-PA 542 CG1089-PA 14..536 65..584 1228 46.8 Plus
alpha-Est5-PB 543 CG1089-PB 15..537 65..584 1228 46.8 Plus
alpha-Est1-PA 565 CG1031-PA 28..559 56..584 1112 44.5 Plus
alpha-Est2-PB 566 CG2505-PB 34..560 62..584 1090 43.7 Plus