Clone FI06053 Report

Search the DGRC for FI06053

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:60
Well:53
Vector:pOTB7
Associated Gene/TranscriptCG17669-RA
Protein status:FI06053.pep: gold
Sequenced Size:1748

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17669 2008-12-18 5.12 accounting

Clone Sequence Records

FI06053.complete Sequence

1748 bp assembled on 2008-10-31

GenBank Submission: BT050480.1

> FI06053.complete
ATAACCAAATAAGTTTCAACGGATCCAGACTTCATCGAAAAACCAAAGCC
ACTCAAGGTCAAAATGCTGTGGGGAATCAGTTCCGCGCTTGATTTATACG
AGGAGTACCTAAGGGCCTTCAAGATCAAGGACGACCCGCTGCCGGAGGAT
GAGCATGCACGCGAGGAAGCAGAAGAAGCGGCCGGAGATAATACTTTGAA
CACCCTAAACATACTCATCTGCGGTGGAGCTGATCCACGGCATGTGATCA
AGACGCTGGCCAAGAGATACACACATCGCATCCGACCCAAACTAAATATC
TATTTACTCGATGGTTGCGCCGAAATTGAAGCCAGGAACATGCTGCTCCT
GGGCGTAGCCCTGGAGGATCCCGAGTCCTTTAACCTGGTGTCCAAGGTGC
ACTTGTTCATGGACCTCTACGGAAATGCGGTGATCCGTCCCAGCTCGCAC
CATTACATGGCAGCCAAGGGACGCACACTGCTCAAAATGGTCACCAATGA
GGAGGAACTTCAGCGCCTGGCTCCCATGCTGAATATAGAAGGACTAAAGT
ACAAGGAACGAGATGGCTTTGAGATGGCTTTCACTTTTTGGCAGCCGCAA
CCGTGGAATGTCTTTGAGGTGACCGCCTACTGGGAGCAAAGGTCGAGGGC
CCTGCTCGGCACCAGGTATGACCATCGCAACGGGGCCTTTGATTGGGACC
TGAGCATGACCCTAAAGGAACGTGGAGGGCAGCAGATCTGTTCGCAGGAG
TACCGCTATTGGCGCGAGACCGGCGTGGCTTTCGTTTTTCCGGAATATGA
GCATTGCAAGCCGAACAAGACACTGGCCGTTGGATTGGTGCGCAATGGAC
GCAACTTCATCCACCGTGGCTATGTGGGTGATATCCAGACTGGACCGTTT
TGTGGCTTCGGGCTGCGCACCGTGGAGGAGCGAATGCATCATTCTGTGCA
CGGTGATAATGATTATCGTGCTACCGATATAACAGAACGCAATCTCATGG
AATTCTTCCATGAATTGCTGACCCAGACAGCCTACGAGCATGATACCACT
CGTTCCCGACGGTATGGCTCTGTTCAGCTGCTGATGACGCCCTTGTTGAA
CCACCAGGAAGAGGACGCTGCTGGGCAAGCGGCTTACGATAAGCCATGGA
TCCACGTGCCCGGAGTAACAGTGCACTTTGTGTCGCCCATGGAGATGGAG
CAGCTGAAAAAGGGTGCAGCTCATTGGAACAATATGTTTGATATCGTCTT
TATGGCCTATAACTATTACTCTTTCTTGAGCAAGGACTTCTTCCAGGCGA
TGCGTGCGCAATCACTTTTTATTCTGGAAACCAAGCTGATGACGGTGGAG
CGCAAAGATCGTGTGCAGGAGTACGAATCCAAAGCTAAAGAACTGATGAA
GGATGCTGGCCTTAAGGCGGCCATCAACTACCAGGCCATCAACGGCAAGA
ACATGTGGCTAAAATACAAAAAGACCGATAAAGATGAACAAGAAGATGAA
GCCGTGACAGAAGCCATGCCAGAAAGTACTTTCAAATATGACACAGACAC
AGATTATGGTGAACCTGCTGAAGAGTATACTGGTCTAGTAATTGAAGAGA
TTCCCTCATCGAATCAGACTGTGGCAGCCATTAAGAAGGAAGTGGAGGCA
GAAGGTCCCCTACAACCAAAAACTAACTTCCCATGAATAAGAAATCCGAA
TCCGAATAAAATGAAATATGCATCTTAAAAAAAAAAAAAAAAAAAAAA

FI06053.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-RA 1729 CG17669-RA 4..1729 1..1726 8600 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14339820..14341545 1726..1 8315 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-RA 1623 CG17669-PA 1..1623 64..1686 8085 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-RA 1726 CG17669-RA 1..1726 1..1726 8600 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-PA 540 CG17669-PA 1..540 64..1683 2796 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18452735..18454462 1728..1 8610 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18453934..18455661 1728..1 8610 99.8 Minus
Blast to na_te.dros performed 2014-11-26 21:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 8466..8661 1317..1516 152 57.1 Plus

FI06053.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:43:19 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14339820..14341545 1..1726 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:16 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1623 64..1686 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:47 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1623 64..1686 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:23 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1623 64..1686 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:19 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1623 64..1686 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:57:53 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 4..1689 1..1686 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:47 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1726 1..1726 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:23 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1726 1..1726 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-31 09:52:09 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 4..1689 1..1686 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:19 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
CG17669-RA 1..1726 1..1726 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:19 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18452737..18454462 1..1726 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:23 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14340242..14341967 1..1726 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:55 Download gff for FI06053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18453936..18455661 1..1726 99   Minus

FI06053.pep Sequence

Translation from 63 to 1685

> FI06053.pep
MLWGISSALDLYEEYLRAFKIKDDPLPEDEHAREEAEEAAGDNTLNTLNI
LICGGADPRHVIKTLAKRYTHRIRPKLNIYLLDGCAEIEARNMLLLGVAL
EDPESFNLVSKVHLFMDLYGNAVIRPSSHHYMAAKGRTLLKMVTNEEELQ
RLAPMLNIEGLKYKERDGFEMAFTFWQPQPWNVFEVTAYWEQRSRALLGT
RYDHRNGAFDWDLSMTLKERGGQQICSQEYRYWRETGVAFVFPEYEHCKP
NKTLAVGLVRNGRNFIHRGYVGDIQTGPFCGFGLRTVEERMHHSVHGDND
YRATDITERNLMEFFHELLTQTAYEHDTTRSRRYGSVQLLMTPLLNHQEE
DAAGQAAYDKPWIHVPGVTVHFVSPMEMEQLKKGAAHWNNMFDIVFMAYN
YYSFLSKDFFQAMRAQSLFILETKLMTVERKDRVQEYESKAKELMKDAGL
KAAINYQAINGKNMWLKYKKTDKDEQEDEAVTEAMPESTFKYDTDTDYGE
PAEEYTGLVIEEIPSSNQTVAAIKKEVEAEGPLQPKTNFP*

FI06053.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12946-PA 684 GF12946-PA 1..467 1..470 1765 66.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20969-PA 536 GG20969-PA 1..535 1..539 2618 90 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22156-PA 587 GH22156-PA 1..459 1..470 1839 71.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-PA 540 CG17669-PA 1..540 1..540 2874 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19384-PA 704 GI19384-PA 1..519 1..530 1912 67.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16700-PA 510 GL16700-PA 1..468 1..472 2052 77.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14606-PA 510 GA14606-PA 1..468 1..472 2061 77.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19904-PA 540 GM19904-PA 1..540 1..540 2806 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25389-PA 540 GD25389-PA 1..540 1..540 2797 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22446-PA 599 GJ22446-PA 1..460 1..471 1888 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23225-PA 524 GK23225-PA 1..463 1..471 1827 68.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13909-PA 540 GE13909-PA 1..533 1..535 2596 89.9 Plus

FI06053.hyp Sequence

Translation from 63 to 1685

> FI06053.hyp
MLWGISSALDLYEEYLRAFKIKDDPLPEDEHAREEAEEAAGDNTLNTLNI
LICGGADPRHVIKTLAKRYTHRIRPKLNIYLLDGCAEIEARNMLLLGVAL
EDPESFNLVSKVHLFMDLYGNAVIRPSSHHYMAAKGRTLLKMVTNEEELQ
RLAPMLNIEGLKYKERDGFEMAFTFWQPQPWNVFEVTAYWEQRSRALLGT
RYDHRNGAFDWDLSMTLKERGGQQICSQEYRYWRETGVAFVFPEYEHCKP
NKTLAVGLVRNGRNFIHRGYVGDIQTGPFCGFGLRTVEERMHHSVHGDND
YRATDITERNLMEFFHELLTQTAYEHDTTRSRRYGSVQLLMTPLLNHQEE
DAAGQAAYDKPWIHVPGVTVHFVSPMEMEQLKKGAAHWNNMFDIVFMAYN
YYSFLSKDFFQAMRAQSLFILETKLMTVERKDRVQEYESKAKELMKDAGL
KAAINYQAINGKNMWLKYKKTDKDEQEDEAVTEAMPESTFKYDTDTDYGE
PAEEYTGLVIEEIPSSNQTVAAIKKEVEAEGPLQPKTNFP*

FI06053.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17669-PA 540 CG17669-PA 1..540 1..540 2874 100 Plus