Clone FI06132 Report

Search the DGRC for FI06132

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:61
Well:32
Vector:pOTB7
Associated Gene/TranscriptCG5103-RA
Protein status:FI06132.pep: gold
Sequenced Size:2280

Clone Sequence Records

FI06132.complete Sequence

2280 bp assembled on 2009-04-28

GenBank Submission: BT082079.1

> FI06132.complete
GCCATCCATGCATTTTACACGTGGGAATTGGAAGAAAAAAGGACTATAAA
TTTCAAAATTAAAAATAAAACTTATAACTTATATAAAAACATTATATGAT
TGTTACGCCAATCGAAGGGAAATTTGAAATGTGGTAAAAATTACAGCACA
ACACAGTCTGTCTTTGATTAGTTTCTCAAAATTAATGAAAATTTGGTTGT
GAAAATGTCGAACGCTAAGCTGGACAGTAAGGTCGTTCAGAACCTGAAGG
ACGTGGCCCAAAAGCTGCGGATCCACTCGATCACCTCGACGCAGGCGGCC
AAGTCGGGACATCCGACGTCCTGTGCCTCGTTGGCCGAGATAATGACGGT
GCTGTTCTTTCAGCAGATGCGCCTAAATCTGAAGCATCCTCGCGATCCTT
CCAGCGATCGATTGGTTCTGTCCAAGGGACATGCTGCACCCATTCTGTAC
GCCGTTTGGGCGGAGGCTGGACTCTTCCCGGTGGAGGAGCTGCGAAATTT
GCGCAAGGTGGACAGTGATCTAGAGGGTCATCCCACTCCACGGCTGAGTT
TCGTCGATGTGAGCACCGGATCCCTGGGACAGGGCATCTCCGTGGCCGCT
GGAATGGCCTATGTGGGCAAACACCTGGACAAGGCCGACTATCGTACATA
TGTGATCGTGGGCGATGGCGAGGCTACCGAAGGAGCAGTCTGGGAATCGC
TCCACTTTGCCGGCCACTACTGCCTGGACAACCTGTGCGTAATCTTCGAT
ATGAACAAGATCTTCTGCTCGGACATAGGCACTGAAATGGAGGTTTATCG
GGAGAGGTTGGACGCCTTCGGGTTCAATGCCCTAGTCTTAAATGGCCACG
ATATTGATGAGCTGGCCAAGGCCTTCATTAATGCGGCCAGCACGAAGGGT
AAGCCCACGGCTCTTTTAGCCAGGACGACTAAGGGAAAGGACTTTCTGGG
CATCGAAGGAATCGAAGAAATGCATGCACAGCCACTGGGTAAGAGGGCCG
AATCTGCAATCAAGCATTTGCAGATGAAAATCGCAAATCCCAACGTCCGC
CTGACACCCAAAAAGGTGGGAAAGTGCGGCCACGCCCCCGAGGTGCATAT
TAACAATATAATGCTGTGCAGTCCGCCCAATTATCGGCTGGGAGATTCGG
TAGCCCCACGCTTAGCCTACGGAACCGCCTTGGCCAAAATCGCTGCTGAT
AATCCTCGGGTAATAGCCCTTGATGGCGATACAAAGAACTCGACATATGC
GGACAAAATGAGGAATGCATTTCCAGAGCGTTTCATCGAGTGCTTCACAG
CACAGCAGAATCTGGTGGGCGTGGCCGTGGGAGCCACCTGTCGACGTCGC
ACTGTGGCCTTCGTTTCGACGTATGCGACCTTTTTCACACGGGCCTTTGA
TCAGATCCGCATGGGCGCAATTTCGCACACGAATGTGAACTTCGCGGGCT
CCCACTGTGGCTGCAGCATCGGCGAGGATGGTCCCTCCCAAATGGGACTG
GAGGACATGGCCATGTTCAGGAGCATTCCCGGGAGCACGGTCTTCTATCC
CACGGACGCAGTGAGCACGGAGAGGGCGGTGGAACTGGCTGCCAATACTA
AGGGCGTGTGCTACATCCGCACCACGTATCCGAGCACAACGGTGATCTAC
AACAATGACGAGGTGTTTGCCGTGGGACTGGGCAAAGTGGTGCGCCAGAA
GCCCTCGGATGAGGTGCTCCTGATTGGAGCCGGCGTCACATTGTACGAGT
GCCTGGCCGCAGCGGAAAGATTGGAGGAGGATTGCATTACGGCACGAGTG
ATCGACCCCTTTACAGTGAAGCCCCTCGATGTCGGATTAATCGTGAAGCA
TGGAAAGCTGTGTCGTGGAAGAATCGTCGTGGTGGAGGATCATTACCAGC
AAGGCGGATTGGGCGAGGCGGTCCTCAGTGCTCTGGCCGACTATCGAAAC
TTTGTGGTCAAGCATCTCTATATTACCACTGTACCGAGATCAGGCCCTCC
TGCTGTTCTGCTGGACATGTTTGGCGTCTCCTCCAGAAATATATACAAAG
CAAGCCTGGCCATCATGAAGAAGTGAGCAGAATGTTCGAAAAAATCGAAA
AAATTGAGAAGTGTAACTTTATAATTTCAAGTACTTTCCGTAATCAAAAC
TTTTAAATATCTCTCTCAACACAAATTATAAATGTAACTATATTTATATT
TTGGTTATCATGCAAATTGAATAAAAAATTAGCAAGAAGTTAATAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI06132.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-RA 2257 CG5103-RA 77..2257 62..2244 10515 98.8 Plus
CG8036-RC 2451 CG8036-RC 325..847 234..756 1010 79.5 Plus
CG8036-RB 2621 CG8036-RB 495..1017 234..756 1010 79.5 Plus
CG8036-RC 2451 CG8036-RC 1377..1719 1277..1619 815 82.5 Plus
CG8036-RB 2621 CG8036-RB 1547..1889 1277..1619 815 82.5 Plus
CG5103-RA 2257 CG5103-RA 1..60 1..60 270 96.6 Plus
CG8036-RC 2451 CG8036-RC 1781..1923 1681..1823 235 77.6 Plus
CG8036-RB 2621 CG8036-RB 1951..2093 1681..1823 235 77.6 Plus
CG8036-RC 2451 CG8036-RC 1976..2064 1876..1964 175 79.7 Plus
CG8036-RB 2621 CG8036-RB 2146..2234 1876..1964 175 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18281767..18282990 2244..1021 6105 99.9 Minus
chr3L 24539361 chr3L 18283052..18284083 1023..1 4960 98.9 Minus
chr3R 27901430 chr3R 4498660..4499286 1277..1903 990 77.2 Plus
chr3R 27901430 chr3R 4497684..4498130 310..756 915 80.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-RA 1872 CG5103-PA 1..1872 205..2076 9105 99.1 Plus
CG8036-RD 1743 CG8036-PD 944..1631 1277..1964 1070 77 Plus
CG8036-RC 1881 CG8036-PC 1082..1769 1277..1964 1070 77 Plus
CG8036-RD 1743 CG8036-PD 7..414 349..756 855 80.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:09 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-RA 2074 CG5103-RA 1..2074 171..2244 10070 99 Plus
CG8036-RD 2179 CG8036-RD 1233..1920 1277..1964 1070 77 Plus
CG8036-RC 2235 CG8036-RC 1289..1976 1277..1964 1070 77 Plus
CG8036-RD 2179 CG8036-RD 257..703 310..756 915 80.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-PA 623 CG5103-PA 1..621 205..2067 3208 100 Plus
CG8036-PC 626 CG8036-PC 1..619 205..2052 2458 74 Plus
CG8036-PB 626 CG8036-PB 1..619 205..2052 2458 74 Plus
CG8036-PD 580 CG8036-PD 1..573 343..2052 2287 74 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18292117..18293348 2252..1021 5935 98.8 Minus
3L 28110227 3L 18293410..18294445 1023..1 4700 97.3 Minus
3R 32079331 3R 8672688..8673314 1277..1903 990 77.2 Plus
3R 32079331 3R 8671712..8672158 310..756 915 80.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18285217..18286448 2252..1021 5935 98.7 Minus
3L 28103327 3L 18286510..18287469 1023..62 4635 98.9 Minus
3R 31820162 3R 8412543..8412989 310..756 915 80.3 Plus
3R 31820162 3R 8413519..8413861 1277..1619 815 82.5 Plus
3L 28103327 3L 18287486..18287545 60..1 270 96.6 Minus
3R 31820162 3R 8413923..8414065 1681..1823 235 77.6 Plus
Blast to na_te.dros performed on 2014-11-27 05:15:21 has no hits.

FI06132.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:28:58 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18283052..18284083 1..1023 95   Minus
chr3L 18281767..18282987 1024..2244 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:07 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..1872 205..2076 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:40 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..1872 205..2076 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:21:47 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..1872 205..2076 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:58 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..1872 205..2076 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 17:10:00 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..2190 54..2244 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:40 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 79..2257 64..2244 98   Plus
CG5103-RA 1..63 1..63 92 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:47 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..2074 171..2244 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:58 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 1..2074 171..2244 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:28:58 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18294383..18294445 1..63 92   Minus
3L 18293410..18294367 64..1023 98 -> Minus
3L 18292125..18293345 1024..2244 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:47 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18287483..18287545 1..63 92   Minus
arm_3L 18286510..18287467 64..1023 98 -> Minus
arm_3L 18285225..18286445 1024..2244 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:29 Download gff for FI06132.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18287483..18287545 1..63 92   Minus
3L 18286510..18287467 64..1023 98 -> Minus
3L 18285225..18286445 1024..2244 98 <- Minus

FI06132.pep Sequence

Translation from 204 to 2075

> FI06132.pep
MSNAKLDSKVVQNLKDVAQKLRIHSITSTQAAKSGHPTSCASLAEIMTVL
FFQQMRLNLKHPRDPSSDRLVLSKGHAAPILYAVWAEAGLFPVEELRNLR
KVDSDLEGHPTPRLSFVDVSTGSLGQGISVAAGMAYVGKHLDKADYRTYV
IVGDGEATEGAVWESLHFAGHYCLDNLCVIFDMNKIFCSDIGTEMEVYRE
RLDAFGFNALVLNGHDIDELAKAFINAASTKGKPTALLARTTKGKDFLGI
EGIEEMHAQPLGKRAESAIKHLQMKIANPNVRLTPKKVGKCGHAPEVHIN
NIMLCSPPNYRLGDSVAPRLAYGTALAKIAADNPRVIALDGDTKNSTYAD
KMRNAFPERFIECFTAQQNLVGVAVGATCRRRTVAFVSTYATFFTRAFDQ
IRMGAISHTNVNFAGSHCGCSIGEDGPSQMGLEDMAMFRSIPGSTVFYPT
DAVSTERAVELAANTKGVCYIRTTYPSTTVIYNNDEVFAVGLGKVVRQKP
SDEVLLIGAGVTLYECLAAAERLEEDCITARVIDPFTVKPLDVGLIVKHG
KLCRGRIVVVEDHYQQGGLGEAVLSALADYRNFVVKHLYITTVPRSGPPA
VLLDMFGVSSRNIYKASLAIMKK*

FI06132.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10824-PA 623 GF10824-PA 1..623 1..623 2758 81.7 Plus
Dana\GF18452-PA 626 GF18452-PA 1..626 1..623 2548 74 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15748-PA 623 GG15748-PA 1..623 1..623 3211 94.5 Plus
Dere\GG11729-PA 626 GG11729-PA 1..625 1..622 2544 73.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17621-PA 626 GH17621-PA 1..626 1..623 2667 77.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-PA 623 CG5103-PA 1..623 1..623 3218 100 Plus
CG8036-PC 626 CG8036-PC 1..625 1..622 2463 73.6 Plus
CG8036-PB 626 CG8036-PB 1..625 1..622 2463 73.6 Plus
CG8036-PD 580 CG8036-PD 1..579 47..622 2292 73.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22533-PA 626 GI22533-PA 1..626 1..623 2601 75.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23966-PA 626 GL23966-PA 1..626 1..623 2672 77.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26462-PA 626 GA26462-PA 1..626 1..623 2673 78 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14947-PA 623 GM14947-PA 1..623 1..623 3284 97.3 Plus
Dsec\GM23748-PA 535 GM23748-PA 47..534 138..622 1940 71.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12349-PA 623 GD12349-PA 1..623 1..623 3292 97.8 Plus
Dsim\GD18560-PA 626 GD18560-PA 1..625 1..622 2549 73.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10136-PA 626 GJ10136-PA 1..626 1..623 2663 77.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13217-PA 626 GK13217-PA 1..626 1..623 2685 77.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22080-PA 623 GE22080-PA 1..623 1..623 3227 95.2 Plus
Dyak\GE25892-PA 626 GE25892-PA 1..625 1..622 2547 73.6 Plus

FI06132.hyp Sequence

Translation from 204 to 2075

> FI06132.hyp
MSNAKLDSKVVQNLKDVAQKLRIHSITSTQAAKSGHPTSCASLAEIMTVL
FFQQMRLNLKHPRDPSSDRLVLSKGHAAPILYAVWAEAGLFPVEELRNLR
KVDSDLEGHPTPRLSFVDVSTGSLGQGISVAAGMAYVGKHLDKADYRTYV
IVGDGEATEGAVWESLHFAGHYCLDNLCVIFDMNKIFCSDIGTEMEVYRE
RLDAFGFNALVLNGHDIDELAKAFINAASTKGKPTALLARTTKGKDFLGI
EGIEEMHAQPLGKRAESAIKHLQMKIANPNVRLTPKKVGKCGHAPEVHIN
NIMLCSPPNYRLGDSVAPRLAYGTALAKIAADNPRVIALDGDTKNSTYAD
KMRNAFPERFIECFTAQQNLVGVAVGATCRRRTVAFVSTYATFFTRAFDQ
IRMGAISHTNVNFAGSHCGCSIGEDGPSQMGLEDMAMFRSIPGSTVFYPT
DAVSTERAVELAANTKGVCYIRTTYPSTTVIYNNDEVFAVGLGKVVRQKP
SDEVLLIGAGVTLYECLAAAERLEEDCITARVIDPFTVKPLDVGLIVKHG
KLCRGRIVVVEDHYQQGGLGEAVLSALADYRNFVVKHLYITTVPRSGPPA
VLLDMFGVSSRNIYKASLAIMKK*

FI06132.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-PA 623 CG5103-PA 1..623 1..623 3218 100 Plus
CG8036-PC 626 CG8036-PC 1..625 1..622 2463 73.6 Plus
CG8036-PB 626 CG8036-PB 1..625 1..622 2463 73.6 Plus
CG8036-PD 580 CG8036-PD 1..579 47..622 2292 73.6 Plus