Clone FI06147 Report

Search the DGRC for FI06147

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:61
Well:47
Vector:pOTB7
Associated Gene/Transcriptscny-RD
Protein status:FI06147.pep: gold
Sequenced Size:4015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Usp36 2008-12-18 5.12 accounting

Clone Sequence Records

FI06147.complete Sequence

4015 bp assembled on 2008-10-14

GenBank Submission: BT046169.1

> FI06147.complete
ATTTTTTATTGTTAAGAAAACATCGAAATACATTTTTGTAAATATCGTGA
AATGCTTTAGGACATTTCGAGAGGCCTATCGCGTCACTTGGCCACTCGCG
AGTTGGCATCCCCAAATGACGAAAATGAAGCGAAAAGAGAATCCGCAGTC
GGAAGAAACACGAGGGAAGGAATTGCCATTATTTTCGAAAGCAGACTTTT
CGTTCTAAAATGCCTGGCCGCGCACGAAATTGAAACAGATCAATCTGTGA
GCGAACGTTTCTTAATCGTAATGCTCAGTAGGCCAACAGATCGAGATCGC
AGCGCGAAAAAGCCAGAAAAAGAAGAGTGCTCCCGAGTGCGTTAGTGTGC
GTGTGTCGGTGTCGCAGTCGGTGTGTGAAACAAGAAGTGTTCGAGAGAGG
GGCGAGGAGAAAAGTGAGCGTAGAGCAGTAGGAGAGTTTTGAAGGACGTG
TGGGCTGTGCAGAAGGATCTCTAGTATCTGCTTTGGATCGCACGCCCATG
TGCATTAGCTAACTGGGTGGCGAAAACCACCAACACACGCCACACCACGC
CCCCCACACCCGTTCAAAATTCCACCGCAAATCCCCAGCCGGAGCATCGC
CATGCCCGTTTCGATGGCCGTATGCGAAACGGCGAATGTCGTCAACGCAG
CGCTGCGCGAATCCCTTGGCGGCAACTCCTCCGCCGGCTCGTCGACTGAC
CAGGCCAAGAGCGGCGAGGACACCAACGGCAGCCTGCAAAATCACATCGT
GGCCAATGCCAAACGCATCCTGATGGCCAAAATCGAATACGAGGAGGTGC
CCAACTACCACGAATCGGTGCTGGAGAACCTCAAGTCCAAATATATTGTC
ATCAAGCCGGGAAATCCAGGCGCCATCAATGGCTTTAGTGGCAAAAACAA
CACAGGCAAACTTGTGGGCGCAAATGGACATGACAATAACGGCGCCCGCA
AGCAAGCGGAGCACCCGAACAATCAGTCGCACCACATCAACCACCACAAT
CATCAGCATCCGACAAGCAATCCCAATGAGCTGCCCAAGCCAAAGAGGGT
CCTCTATCCGCGGGAGAACATACGCATTGGCTGGAAGCAGTCGGAGCGCA
AATGGCAGGTGGGCACGGGCATGATCAATGTGGGCAACACCTGCTACCTC
AACTCAACGCTTCAGGCGCTCCTGCACATACCCGCCCTGGCCAATTGGCT
CGTTTCGGAGCAGGCGCATCTGGCTGACTGCAATGTGGCCGAACCTGGCA
GCGGTTGCATCATTTGCGCCATGACCAAAACACTTTTGGCCACCCAAAGC
AATCAGTCGGCCGTCAGGCCCTTCCTCATCTACTCGAAGCTAAAGCAGAT
CTGCAAACACATGGTCGTTGGTCGCCAAGAGGATGCGCACGAGTTCCTGC
GCTTCCTGGTCGAGGCCATGGAGCGGGCGTATTTGATGCGGTTTCGTAAC
TACAAAGAGCTGGATCAGTTGGTTAAGGAGACCACGCCGCTGGGACAGAT
CTTTGGCGGCTATCTGCGCAGCGAGGTGCGCTGTCTGAGCTGCAACCATG
TGTCCATTACGTTTCAGCACTTCCAGGATCTGTTGCTCGACATCCGCAAG
GCAGACTCCTTGGAGGATGCTTTCGAGGGGCACTTTTCTCGCGAACGGCT
AGAGGATATGGGCTACAAGTGCGAGGGATGCAAGAAGAAGGTATCTGCCA
CAAAGCAATTCTCTTTGGAGCGTGCCCCAATCACGCTTTGTATACAGCTG
AAGCGATTCTCCATGATCGGCAACAAACTGACCAAGCAGATCTCCTTCAA
GTCACGCATAGATTTGAGCAAATACGCAGCCCGTTCACAAGCGGCTCAGG
CTCAACCGCTCACCTATCGCCTGGTGTCGATGGTCACTCACTTGGGAGCA
TCCCAGCACTGCGGTCACTACACGGCCATTGGCTCCACGGATACGGGCAG
CTTTTACAACTTCGACGACAGCTACGTGCGGCCAATCGCAATGCACAGTG
TGTGCAACACAAATGCCTATATAATGTTTTTCGAACTGGACCTCTCACAG
GCTGCCAGTCCGGCGGCCAACAGGCCCAATGGAGTGCGTTTGACCAACGG
ACACAGCACAACGCCAGTGCCGGCGGCGACTGTGTCTTCGCCTTCACCAA
CGCGTTTCATTGGTCCTCAACTGCCGGCGGGTGGAGCAAACGGTTACACT
AATGGCAATGCCCAGAAAACCGCCATCCAGTTCAAGCAACAAAACCAGCA
AAGTCCACAGAACGGACTCCAGCTGGGTACCGGAAAGTTTCAGGACACTG
CGAAGCCTCCACTGGTTGGCGCTCACGCTAAAGGCGAAGCTACTTCAGCT
CCCACTGCAAATGGTAACAAAAGTTCCTCCCCAAGCAGCAACAGCAGCAG
CAACCACAAATCAATAAACCAGCAACAATATCTGCCAATTTCCTCGGATG
ATGAAGACATCGAGGATGAGATGAAGCCCAGACCAACGACAGCCCAGCTA
CCGAGCATGCCCAATATGACGGAGAATCATACGGAGCCTAAGGCAAAGTC
TCCTGTAAAGATTCAAGTAAAGACTCCCGTCAAAACGCCACTGAAAAGTC
TTGTGCCCTACGAATCCGCATCTGAGGAGGAGGAGGCGCCTCTACCGAAT
CCCCGCAAGCGTCCAAGTGGGGAGGATTCTAGCGAGTCGGACCAAGAGTC
TGGCCAGACCAATGGTCACAGTAAGACCAATGGCAGCCACACCAACGGCT
CAGCCTCGTCATCGGTTCACGTTAACAACAGCAAACAAAAGACTGATGCC
ATAGACGAGATATTCAAGAGCCTAAAAAAGTCCGCAGACAGTGATGAGGA
CGACGATGAGGAGGAGCCCAGCATTCAGCTAACGAATGGCTGGCACCCAC
AGAAGCAATCACAGTCTCAAAGCAAAGCACCACCATCGCCAAAGACGCCA
CCCTCGCCAGCGGTCATCAAATCGAAAACGGGTATCTGGAAAGTTACGCG
TAACGATGAGGTCGATGCCATCGAAGATGATGTTGACGTCGTGGTGGTGG
AGGGATCGCCGGTGAAAATTCCGACGCCGAACAAGAACCATCGCAATCCC
TTCTCGAGTAGCAAGCCCTCCACGGACTCGCCCGCAACGCCAGGCGCCAA
GCGCCAAAAGTTGCTCAACGGCAGTGCGCTCAAGTCGCACCAGCAGCCAA
GGGTGGGCAATGGCTACCAGAGCAATGCCACCTCGAATGGAAGCACCATC
AATGAGCTGCTGAAGCAATCGTATCGTGGATACGGCTCCCCCGTGCTCAG
TTGGAATGGCAAGCCCGCGGAGCTCGAAAAGGAGCTACTGGTGGATGCGC
GTGAGCAGCGGCAGCGGGACATCGACGACGACGAAGAGAACGAGATGGAT
CGTGGACGTCAGCGGAAGGTGAAGTCCGGTTCGGCTAAGGGAAACAATGC
TAGCAACAGCACGCCCGGGTACAATCCATTCCAGGAGTACGAGGGCCAGA
AGCGCTGGAACAAGAACGGCGGAGGTGGAGGATTTCCGCGATTCTACAAT
CAGAACTATCGCCAGAACTTCCAGCAGCGCAACAAGTTCAAGTTCAACCG
CTTCGGAGGACCAGGAAGCGCCAAGTTCCAGCAGCAGCGAGCCCTGCAAC
GACATCTGTCCGCCGGCGGTGGCTTCAGTCGGCGACAACCGTCGGCGCAG
CAGCAGCAGCAAACCTAACTGGATGCGGATAGGCGAGGGTCAGGAGAAAG
AGATGACGCCGATGCGACTGCGGCGTGTGCATTTGTTATTGGATTTCAAT
TTCGCATGAGTTTTGTAAACGTTTTTTAACTGCTGATGATGAACATATTA
GAAGTAGGAGTAGGCGTAGGACTGTAAGCTATAAGCTAGAACATAATTGT
TGCCTCCCAAAATCATCCCCAACCTTCACCGAAGCACACAGTCCCATTAG
AAACTAAGGCTATCATTAAGTACGATAAAAAAAAAAAGAAATGAAAAAAA
AAAAAAAAAAAAAAA

FI06147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
scny-RD 4441 scny-RD 11..3995 1..3985 19670 99.5 Plus
scny-RA 4135 scny-RA 1..3334 1..3334 16460 99.5 Plus
scny.b 3756 scny.b 925..3747 1163..3985 13920 99.5 Plus
scny.b 3756 scny.b 1..928 182..1109 4580 99.5 Plus
scny-RA 4135 scny-RA 3475..4126 3334..3985 3215 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5764953..5766598 1689..3334 8095 99.5 Plus
chr3L 24539361 chr3L 5761525..5762456 1..932 4630 99.8 Plus
chr3L 24539361 chr3L 5764139..5764900 932..1693 3765 99.6 Plus
chr3L 24539361 chr3L 5767711..5768364 3333..3986 3240 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
scny-RD 3117 CG5505-PD 1..3117 602..3718 15375 99.6 Plus
scny-RC 2847 CG5505-PC 61..2847 932..3718 13740 99.5 Plus
scny-RB 2907 CG5505-PB 121..2907 932..3718 13740 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
scny-RD 4417 CG5505-RD 1..3985 1..3985 19670 99.6 Plus
scny-RH 4303 CG5505-RH 1..3213 122..3334 15855 99.6 Plus
scny-RG 4470 CG5505-RG 1..3213 122..3334 15855 99.6 Plus
scny-RH 4303 CG5505-RH 3645..4297 3333..3985 3220 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
scny-PD 1038 CG5505-PD 1..1032 602..3697 4166 100 Plus
scny-PH 976 CG5505-PH 1..911 602..3334 3783 100 Plus
scny-PG 976 CG5505-PG 1..911 602..3334 3783 100 Plus
scny-PC 948 CG5505-PC 21..942 932..3697 3605 100 Plus
scny-PB 968 CG5505-PB 41..962 932..3697 3605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5772431..5774076 1689..3334 8110 99.5 Plus
3L 28110227 3L 5769002..5769933 1..932 4615 99.7 Plus
3L 28110227 3L 5771617..5772378 932..1693 3765 99.6 Plus
3L 28110227 3L 5775187..5775839 3333..3985 3220 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5765531..5767176 1689..3334 8110 99.5 Plus
3L 28103327 3L 5762102..5763033 1..932 4615 99.6 Plus
3L 28103327 3L 5764717..5765478 932..1693 3765 99.6 Plus
3L 28103327 3L 5768287..5768939 3333..3985 3220 99.5 Plus
Blast to na_te.dros performed 2014-11-26 21:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2415 2325..2435 153 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6851 2336..2435 146 65.3 Plus
roo 9092 roo DM_ROO 9092bp 1057..1147 2349..2437 143 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6889 2360..2503 137 62 Plus
roo 9092 roo DM_ROO 9092bp 1050..1153 2302..2409 135 60.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6789 2364..2427 128 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1508..1619 2326..2433 127 59.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2767..2830 2366..2427 125 70.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2401..2451 2384..2432 124 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5634..5698 2368..2432 118 64.6 Plus

FI06147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:42:35 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5767713..5768370 3335..3993 99   Plus
chr3L 5764955..5766598 1691..3334 99 -> Plus
chr3L 5764140..5764897 933..1690 99 -> Plus
chr3L 5761525..5762456 1..932 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:28 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
Usp36-RD 1..3117 602..3718 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:21 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3117 602..3718 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:36:34 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3117 602..3718 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:35 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3117 602..3718 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:17 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
Usp36-RD 1..3991 1..3993 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:20 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3991 1..3993 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:36:34 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3870 122..3993 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-14 10:10:01 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
Usp36-RD 1..3991 1..3993 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:35 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 1..3991 1..3993 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:35 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5775189..5775845 3335..3993 99   Plus
3L 5772433..5774076 1691..3334 99 -> Plus
3L 5771618..5772375 933..1690 99 -> Plus
3L 5769002..5769933 1..932 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:36:34 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5768289..5768945 3335..3993 99   Plus
arm_3L 5765533..5767176 1691..3334 99 -> Plus
arm_3L 5764718..5765475 933..1690 99 -> Plus
arm_3L 5762102..5763033 1..932 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:11 Download gff for FI06147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5768289..5768945 3335..3993 99   Plus
3L 5765533..5767176 1691..3334 99 -> Plus
3L 5764718..5765475 933..1690 99 -> Plus
3L 5762102..5763033 1..932 99 -> Plus

FI06147.pep Sequence

Translation from 601 to 3717

> FI06147.pep
MPVSMAVCETANVVNAALRESLGGNSSAGSSTDQAKSGEDTNGSLQNHIV
ANAKRILMAKIEYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGKNN
TGKLVGANGHDNNGARKQAEHPNNQSHHINHHNHQHPTSNPNELPKPKRV
LYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWL
VSEQAHLADCNVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQI
CKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQI
FGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAFEGHFSRERL
EDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISFK
SRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGS
FYNFDDSYVRPIAMHSVCNTNAYIMFFELDLSQAASPAANRPNGVRLTNG
HSTTPVPAATVSSPSPTRFIGPQLPAGGANGYTNGNAQKTAIQFKQQNQQ
SPQNGLQLGTGKFQDTAKPPLVGAHAKGEATSAPTANGNKSSSPSSNSSS
NHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTENHTEPKAKS
PVKIQVKTPVKTPLKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQES
GQTNGHSKTNGSHTNGSASSSVHVNNSKQKTDAIDEIFKSLKKSADSDED
DDEEEPSIQLTNGWHPQKQSQSQSKAPPSPKTPPSPAVIKSKTGIWKVTR
NDEVDAIEDDVDVVVVEGSPVKIPTPNKNHRNPFSSSKPSTDSPATPGAK
RQKLLNGSALKSHQQPRVGNGYQSNATSNGSTINELLKQSYRGYGSPVLS
WNGKPAELEKELLVDAREQRQRDIDDDEENEMDRGRQRKVKSGSAKGNNA
SNSTPGYNPFQEYEGQKRWNKNGGGGGFPRFYNQNYRQNFQQRNKFKFNR
FGGPGSAKFQQQRALQRHLSAGGGFSRRQPSAQQQQQT*

FI06147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23992-PA 1091 GF23992-PA 1..1080 1..1031 3589 70 Plus
Dana\GF23156-PA 899 GF23156-PA 566..889 172..477 320 28.3 Plus
Dana\GF10813-PA 668 GF10813-PA 331..660 173..477 294 26.4 Plus
Dana\GF17759-PA 3889 GF17759-PA 1996..2240 161..416 179 25.3 Plus
Dana\GF16711-PA 416 GF16711-PA 212..388 293..467 177 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15285-PA 1085 GG15285-PA 1..1078 1..1032 4495 87.5 Plus
Dere\GG24410-PA 895 GG24410-PA 562..885 172..477 324 28.6 Plus
Dere\GG15734-PA 496 GG15734-PA 159..489 173..478 275 26.1 Plus
Dere\GG19743-PA 1414 GG19743-PA 1090..1412 173..478 265 26.2 Plus
Dere\GG11165-PA 364 GG11165-PA 25..336 173..467 234 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16215-PA 1240 GH16215-PA 1..1035 1..913 2455 54.8 Plus
Dgri\GH16215-PA 1240 GH16215-PA 1108..1227 911..1028 351 70.2 Plus
Dgri\GH18183-PA 901 GH18183-PA 574..890 172..477 295 27.8 Plus
Dgri\GH18640-PA 717 GH18640-PA 348..709 142..477 287 25.7 Plus
Dgri\GH17708-PA 847 GH17708-PA 505..845 157..478 263 27.1 Plus
Dgri\GH17103-PA 241 GH17103-PA 43..237 297..481 222 29.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
scny-PD 1038 CG5505-PD 1..1038 1..1038 5455 100 Plus
scny-PC 948 CG5505-PC 21..948 111..1038 4894 100 Plus
scny-PB 968 CG5505-PB 41..968 111..1038 4894 100 Plus
scny-PH 976 CG5505-PH 1..911 1..911 4772 100 Plus
scny-PG 976 CG5505-PG 1..911 1..911 4772 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13361-PA 1185 GI13361-PA 1..1170 1..1029 3084 58.1 Plus
Dmoj\GI10137-PA 908 GI10137-PA 574..897 172..477 331 29.5 Plus
Dmoj\GI11709-PA 710 GI11709-PA 372..702 173..477 286 26.9 Plus
Dmoj\GI15450-PA 1158 GI15450-PA 819..1156 160..478 278 26.9 Plus
Dmoj\GI11427-PA 849 GI11427-PA 433..800 173..477 257 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16307-PA 530 GL16307-PA 1..526 1..528 2077 77 Plus
Dper\GL16308-PA 451 GL16308-PA 1..441 636..1032 1058 61.3 Plus
Dper\GL12603-PA 901 GL12603-PA 563..886 172..477 331 30 Plus
Dper\GL13296-PA 820 GL13296-PA 478..818 155..478 261 25.7 Plus
Dper\GL22694-PA 799 GL22694-PA 526..777 144..386 230 27.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18934-PA 1059 GA18934-PA 1..1047 1..1032 3304 69.8 Plus
Dpse\GA19137-PA 901 GA19137-PA 563..886 172..477 331 30 Plus
Dpse\GA18001-PA 494 GA18001-PA 141..487 144..478 275 26.6 Plus
Dpse\GA19137-PB 328 GA19137-PB 77..313 259..477 265 31.2 Plus
Dpse\GA13118-PA 872 GA13118-PA 530..870 155..478 262 26.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14719-PA 1059 GM14719-PA 1..1059 1..1038 4603 89.6 Plus
Dsec\GM15069-PA 896 GM15069-PA 563..886 172..477 325 28.6 Plus
Dsec\GM14932-PA 192 GM14932-PA 2..184 305..477 197 28.6 Plus
Dsec\GM26467-PA 424 GM26467-PA 220..396 293..467 182 29.4 Plus
Dsec\GM23472-PA 3776 GM23472-PA 1867..2111 161..416 175 25.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13899-PA 988 GD13899-PA 21..988 111..1038 4130 90.2 Plus
Dsim\GD19401-PA 896 GD19401-PA 563..886 172..477 326 28.6 Plus
Dsim\GD12336-PA 496 GD12336-PA 159..489 173..478 276 26.6 Plus
Dsim\GD17542-PA 398 GD17542-PA 74..396 173..478 237 27 Plus
Dsim\GD20983-PA 364 GD20983-PA 25..336 173..467 235 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13192-PA 1214 GJ13192-PA 1..1196 1..1028 2882 56.4 Plus
Dvir\GJ23355-PA 906 GJ23355-PA 572..895 172..477 316 28.6 Plus
Dvir\GJ11383-PA 704 GJ11383-PA 365..696 173..477 293 26.6 Plus
Dvir\GJ19166-PA 938 GJ19166-PA 595..936 156..478 268 26 Plus
Dvir\GJ13624-PA 1601 GJ13624-PA 1188..1556 173..477 265 27.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17299-PA 1311 GK17299-PA 1..892 1..741 2065 53.5 Plus
Dwil\GK17299-PA 1311 GK17299-PA 991..1299 788..1028 567 47.3 Plus
Dwil\GK12180-PA 925 GK12180-PA 591..914 172..477 322 28 Plus
Dwil\GK17362-PA 1652 GK17362-PA 1235..1608 173..477 256 27.4 Plus
Dwil\GK16418-PA 1396 GK16418-PA 1069..1394 173..478 228 25.5 Plus
Dwil\GK11483-PA 718 GK11483-PA 520..710 297..477 204 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21508-PA 1082 GE21508-PA 1..1075 1..1032 4544 89.2 Plus
Dyak\GE25711-PA 895 GE25711-PA 514..885 135..477 319 27.4 Plus
Dyak\GE22066-PA 679 GE22066-PA 342..671 173..477 287 26.6 Plus
Dyak\GE17938-PA 1409 GE17938-PA 1085..1407 173..478 256 26.2 Plus
Dyak\GE10332-PA 364 GE10332-PA 25..336 173..467 233 27.2 Plus

FI06147.hyp Sequence

Translation from 601 to 3717

> FI06147.hyp
MPVSMAVCETANVVNAALRESLGGNSSAGSSTDQAKSGEDTNGSLQNHIV
ANAKRILMAKIEYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGKNN
TGKLVGANGHDNNGARKQAEHPNNQSHHINHHNHQHPTSNPNELPKPKRV
LYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWL
VSEQAHLADCNVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQI
CKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQI
FGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAFEGHFSRERL
EDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISFK
SRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGS
FYNFDDSYVRPIAMHSVCNTNAYIMFFELDLSQAASPAANRPNGVRLTNG
HSTTPVPAATVSSPSPTRFIGPQLPAGGANGYTNGNAQKTAIQFKQQNQQ
SPQNGLQLGTGKFQDTAKPPLVGAHAKGEATSAPTANGNKSSSPSSNSSS
NHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTENHTEPKAKS
PVKIQVKTPVKTPLKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQES
GQTNGHSKTNGSHTNGSASSSVHVNNSKQKTDAIDEIFKSLKKSADSDED
DDEEEPSIQLTNGWHPQKQSQSQSKAPPSPKTPPSPAVIKSKTGIWKVTR
NDEVDAIEDDVDVVVVEGSPVKIPTPNKNHRNPFSSSKPSTDSPATPGAK
RQKLLNGSALKSHQQPRVGNGYQSNATSNGSTINELLKQSYRGYGSPVLS
WNGKPAELEKELLVDAREQRQRDIDDDEENEMDRGRQRKVKSGSAKGNNA
SNSTPGYNPFQEYEGQKRWNKNGGGGGFPRFYNQNYRQNFQQRNKFKFNR
FGGPGSAKFQQQRALQRHLSAGGGFSRRQPSAQQQQQT*

FI06147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
scny-PD 1038 CG5505-PD 1..1038 1..1038 5455 100 Plus
scny-PC 948 CG5505-PC 21..948 111..1038 4894 100 Plus
scny-PB 968 CG5505-PB 41..968 111..1038 4894 100 Plus
scny-PH 976 CG5505-PH 1..911 1..911 4772 100 Plus
scny-PG 976 CG5505-PG 1..911 1..911 4772 100 Plus