Clone FI06150 Report

Search the DGRC for FI06150

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:61
Well:50
Vector:pOTB7
Associated Gene/TranscriptCG15483-RA
Protein status:FI06150.pep: gold
Sequenced Size:1399

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15483 2008-12-18 5.12 accounting

Clone Sequence Records

FI06150.complete Sequence

1399 bp assembled on 2008-11-04

GenBank Submission: BT050570.1

> FI06150.complete
AAGCCCGAATACAATTTGTGGAAAGCCCAAAAAGAAAATCGTAACAATAT
GTTTCGAATCTCTGGCCTTCTGAGTTCACTCGTAGTCCTTACTTTTGTTC
TGGAAATCAGTTGCCTGGAGAATGGCACCCTGGCCAAGCTGAAAAAGTTT
GTGAACTGTGAGTCTAAGGCTTACAAGTCCAGCAATGCGATCTACAAGGA
TTACTGGGTGCTGGAGAACTATGTAATGGCTGATCACGGCGATATTCCGT
GCTATTCGAATGTGACCTACACCACCCATGCGGACTATACGTATCTGGAT
AATGTGGTGCCGCTCCTGGAACGCTGGCGATCGCCCCTCAGCCTGGCCAT
ATATGCTCCTGGCACGGACTTCGAGCCCACTATACACAGCATTTTGTACC
TGCTGCAGTGCCATCCTGGCCACGACCTGGTTCGCCAGCTGTGCAGCATT
CATTTGTACTTCGATGTGGAGCACTTGCCCCAGGTGGTTCTGCCACCCGA
AACGACTCTAAGGGAGCCAGCCAACTGTAGTGGACCACCGCCATATGAGA
ATGTCGTTAAAGGGAACATGTACAGGTCTCGAAACACACTGGATTATCCC
GTCAATATGGGACGCAACGTTGCACGCCGGGCTTCGCTGACGCACTACGT
CCTGGCCTCGGACATCGAGCTCTATCCCACGCCCGGATTGGTGCCCGACT
ATATGCATTTCCTTGGCCGCCAAGTGATTGGAATTCCAGGACAGCAGCCT
ACTTCGCCGTTGGTCCATGTACTGCGGATTTTCGAGGTAATGGCCAATGT
ATCTGTACCGAACACCAAGCCAGAGTTGCAAGAGATGTTGAAGTCGGGCG
AAGCTGTGCCATTTCACATGGACATCTGTGAGGCGTGCCATAGGGGACCC
AACCTGGAGGAGTGGATAAATGCGAGCGTTGTGTCCAAGGAACTGAATGT
CTTCAATGTTGGCCACCGCTCGGAAAATAACAACAATTGGGAGCCAATAT
TTTTGGGCACCGTCGAGGATCCTCCATACGATGAGCGATTAACGTGGGAG
GGTCAACGGGACAAGATGACCCAGGCGTATGCCATGTGCGTTCTGGACTA
CGAGTTCCATATCCTGGACAACGCCTTCCTGGTCCATAAGCCCGGCATCA
AACAGCCAGGCAATCGTAAGGAGATCTTCCCTCAAGCCCGCCGAACCAAT
GGGCTTATCGATAAAAAGATCTCCAGGGAGATGCGGATGATGTACGGTTC
TCGGAATGGTTGTGTTATTTAGATGTAATCCTGCTATAAAAAAGTGCTAT
TTCAAATTCAATGTTTAGTAAAATGTGTGTTTACGATTTAGGGAAATACA
AATTGTAATAAGTATAGCTTAAGCTAGTTTAAAAAAAAAAAAAAAAAAA

FI06150.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-RA 1461 CG15483-RA 80..1461 1..1380 6750 99.3 Plus
CG9171.b 2889 CG9171.b 1596..1702 1045..1151 250 82.2 Plus
CG9171.a 3071 CG9171.a 1778..1884 1045..1151 250 82.2 Plus
CG9171.b 2889 CG9171.b 828..890 265..327 150 82.5 Plus
CG9171.a 3071 CG9171.a 1010..1072 265..327 150 82.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12759817..12760541 725..1 3535 99.2 Minus
chr2L 23010047 chr2L 12759047..12759705 1380..724 3155 98.9 Minus
chr2L 23010047 chr2L 5768517..5768581 1151..1087 190 86.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-RA 1224 CG15483-PA 1..1224 49..1272 6015 99.4 Plus
CG9171-RG 1635 CG9171-PG 1408..1514 1045..1151 250 82.2 Plus
CG9171-RF 1635 CG9171-PF 1408..1514 1045..1151 250 82.2 Plus
CG9171-RG 1635 CG9171-PG 579..756 204..381 185 73.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-RA 1382 CG15483-RA 1..1382 1..1380 6740 99.3 Plus
CG9171-RG 3950 CG9171-RG 1999..2105 1045..1151 250 82.2 Plus
CG9171-RF 3736 CG9171-RF 1785..1891 1045..1151 250 82.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-PA 407 CG15483-PA 1..407 49..1269 2117 100 Plus
CG9171-PG 544 CG9171-PG 171..544 136..1269 1046 50.8 Plus
CG9171-PF 544 CG9171-PF 171..544 136..1269 1046 50.8 Plus
CG9171-PE 544 CG9171-PE 171..544 136..1269 1046 50.8 Plus
CG9171-PD 544 CG9171-PD 171..544 136..1269 1046 50.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12761116..12761840 725..1 3595 99.7 Minus
2L 23513712 2L 12760344..12761004 1382..724 3165 98.9 Minus
2L 23513712 2L 5769437..5769501 1151..1087 190 86.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12761116..12761840 725..1 3595 99.7 Minus
2L 23513712 2L 12760344..12761004 1382..724 3175 98.9 Minus
2L 23513712 2L 5769437..5769501 1151..1087 190 86.1 Minus
2L 23513712 2L 5770439..5770501 327..265 150 82.5 Minus
Blast to na_te.dros performed on 2014-11-26 19:48:05 has no hits.

FI06150.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:00:03 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12759819..12760541 1..723 99   Minus
chr2L 12759047..12759705 724..1380 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:29 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1224 49..1272 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:22 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1224 49..1272 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:23 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1224 49..1272 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:03 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1224 49..1272 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:46 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1272 1..1272 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:21 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1382 1..1380 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:23 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1382 1..1380 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 16:31:05 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1272 1..1272 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:03 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 1..1382 1..1380 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:00:03 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12761118..12761840 1..723 99   Minus
2L 12760346..12761004 724..1380 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:23 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12761118..12761840 1..723 99   Minus
arm_2L 12760346..12761004 724..1380 98 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:34 Download gff for FI06150.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12761118..12761840 1..723 99   Minus
2L 12760346..12761004 724..1380 98 <- Minus

FI06150.pep Sequence

Translation from 0 to 1271

> FI06150.pep
KPEYNLWKAQKENRNNMFRISGLLSSLVVLTFVLEISCLENGTLAKLKKF
VNCESKAYKSSNAIYKDYWVLENYVMADHGDIPCYSNVTYTTHADYTYLD
NVVPLLERWRSPLSLAIYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSI
HLYFDVEHLPQVVLPPETTLREPANCSGPPPYENVVKGNMYRSRNTLDYP
VNMGRNVARRASLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQP
TSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGP
NLEEWINASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWE
GQRDKMTQAYAMCVLDYEFHILDNAFLVHKPGIKQPGNRKEIFPQARRTN
GLIDKKISREMRMMYGSRNGCVI*

FI06150.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15654-PA 411 GF15654-PA 1..411 17..423 1408 63.1 Plus
Dana\GF14302-PA 574 GF14302-PA 201..574 46..423 1050 50.5 Plus
Dana\GF14309-PA 398 GF14309-PA 74..398 46..361 576 36.5 Plus
Dana\GF11373-PA 377 GF11373-PA 22..324 66..379 226 24.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10238-PA 407 GG10238-PA 1..407 17..423 1822 82.8 Plus
Dere\GG24282-PA 548 GG24282-PA 175..548 46..423 1059 51.1 Plus
Dere\GG24286-PA 470 GG24286-PA 88..468 46..421 724 37.9 Plus
Dere\GG22943-PA 389 GG22943-PA 34..336 66..379 240 24.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10688-PA 542 GH10688-PA 169..542 46..423 1051 50.8 Plus
Dgri\GH10695-PA 449 GH10695-PA 64..448 46..422 690 37.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-PA 407 CG15483-PA 1..407 17..423 2192 100 Plus
CG9171-PG 544 CG9171-PG 171..544 46..423 1046 50.8 Plus
CG9171-PF 544 CG9171-PF 171..544 46..423 1046 50.8 Plus
CG9171-PE 544 CG9171-PE 171..544 46..423 1046 50.8 Plus
CG9171-PD 544 CG9171-PD 171..544 46..423 1046 50.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11204-PA 532 GI11204-PA 159..532 46..423 1055 51.1 Plus
Dmoj\GI21341-PA 390 GI21341-PA 20..390 47..423 938 45.9 Plus
Dmoj\GI11232-PA 458 GI11232-PA 73..457 46..422 708 36 Plus
Dmoj\GI18863-PA 385 GI18863-PA 39..341 66..379 207 24.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19727-PA 637 GL19727-PA 198..636 5..422 1237 55.9 Plus
Dper\GL26639-PA 471 GL26639-PA 85..470 47..422 741 36.9 Plus
Dper\GL19115-PA 240 GL19115-PA 72..240 254..423 478 54.1 Plus
Dper\GL26378-PA 643 GL26378-PA 271..578 67..380 323 30.2 Plus
Dper\GL26376-PA 415 GL26376-PA 60..367 67..380 279 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13763-PA 411 GA13763-PA 6..410 27..422 1238 59.6 Plus
Dpse\GA21591-PA 561 GA21591-PA 188..561 46..423 1048 49.7 Plus
Dpse\GA10796-PA 471 GA10796-PA 85..470 47..422 738 36.9 Plus
Dpse\GA28839-PA 673 GA28839-PA 301..608 67..380 316 29.8 Plus
Dpse\GA28838-PA 416 GA28838-PA 60..367 67..380 274 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25976-PA 407 GM25976-PA 1..407 17..423 2068 92.9 Plus
Dsec\GM18003-PA 339 GM18003-PA 87..279 46..230 364 36.8 Plus
Dsec\GM17997-PA 339 GM17997-PA 237..339 321..423 318 58.1 Plus
Dsec\GM18308-PA 408 GM18308-PA 86..355 66..379 226 24.5 Plus
Dsec\GM18004-PA 63 GM18004-PA 1..61 362..421 143 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22096-PA 335 GD22096-PA 1..330 17..350 1665 91.9 Plus
Dsim\GD22631-PA 544 GD22631-PA 171..544 46..423 1053 50.5 Plus
Dsim\GD14937-PA 335 GD14937-PA 5..333 102..421 613 38.1 Plus
Dsim\GD15463-PA 389 GD15463-PA 34..336 66..379 263 25.9 Plus
Dsim\GD22097-PA 61 GD22097-PA 1..61 362..423 227 69.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18327-PA 547 GJ18327-PA 174..547 46..423 1059 51.3 Plus
Dvir\GJ11128-PA 396 GJ11128-PA 19..396 40..423 906 44.8 Plus
Dvir\GJ12303-PA 461 GJ12303-PA 75..460 46..422 763 39.1 Plus
Dvir\GJ20432-PA 208 GJ20432-PA 2..166 205..379 158 26.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15419-PA 551 GK15419-PA 178..551 46..423 1059 50.8 Plus
Dwil\GK15424-PA 482 GK15424-PA 95..481 46..422 739 37.8 Plus
Dwil\GK21937-PA 378 GK21937-PA 27..377 66..423 266 24.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12044-PA 407 GE12044-PA 1..407 17..423 1862 83.5 Plus
Dyak\GE18978-PA 549 GE18978-PA 176..549 46..423 1050 50.5 Plus
Dyak\GE18982-PA 469 GE18982-PA 87..467 46..421 728 37.5 Plus
Dyak\GE14380-PA 389 GE14380-PA 34..336 66..379 242 24.9 Plus

FI06150.hyp Sequence

Translation from 0 to 1271

> FI06150.hyp
KPEYNLWKAQKENRNNMFRISGLLSSLVVLTFVLEISCLENGTLAKLKKF
VNCESKAYKSSNAIYKDYWVLENYVMADHGDIPCYSNVTYTTHADYTYLD
NVVPLLERWRSPLSLAIYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSI
HLYFDVEHLPQVVLPPETTLREPANCSGPPPYENVVKGNMYRSRNTLDYP
VNMGRNVARRASLTHYVLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQP
TSPLVHVLRIFEVMANVSVPNTKPELQEMLKSGEAVPFHMDICEACHRGP
NLEEWINASVVSKELNVFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWE
GQRDKMTQAYAMCVLDYEFHILDNAFLVHKPGIKQPGNRKEIFPQARRTN
GLIDKKISREMRMMYGSRNGCVI*

FI06150.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-PA 407 CG15483-PA 1..407 17..423 2192 100 Plus
CG9171-PG 544 CG9171-PG 171..544 46..423 1046 50.8 Plus
CG9171-PF 544 CG9171-PF 171..544 46..423 1046 50.8 Plus
CG9171-PE 544 CG9171-PE 171..544 46..423 1046 50.8 Plus
CG9171-PD 544 CG9171-PD 171..544 46..423 1046 50.8 Plus