Clone FI06328 Report

Search the DGRC for FI06328

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:63
Well:28
Vector:pOTB7
Associated Gene/TranscriptCG15143-RA
Protein status:FI06328.pep: gold
Sequenced Size:3538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15143 2008-12-18 5.12 accounting

Clone Sequence Records

FI06328.complete Sequence

3538 bp assembled on 2008-10-14

GenBank Submission: BT046170.1

> FI06328.complete
AAAATATAAAAATATAAAAAAAAACACAATGTCCAAACACAATACACGAC
TCGATAGGCATGTTAAGTTTAGGATTCTTCAGGAGGACAGGTTACAATCA
CCGAGACAAAAAGAGGATAATATCAAACGGAAAAAGAGCACTTCCAAATC
TGAAAATCTTACTGAACGTGGCCTATCATCTTGTCTGATCAACAGCTCGG
TAGATCTGCGGATCACAGGAGGTGAGAATGACCCAGCACAGCGCAATGTT
GGAAAATTGCCTCGCACCGACAGCGAGTGTCAGTTCAAAGCTCCGGGATA
CCGATTTCTTACCGAACAAGATACTACAGTGAACACCCATGAGGTCAAGA
TGAGCCCCAGGGTAGTGACGAAAAAGGATTTAAGGCACAAATGTGATTTC
TTTGCTAAGAACAAGGACGCACGACCGTTTAAGAATAAGATCACGCAGAC
GCTTTACAGAGAATCCTCTGCGCAGACAATGGCTTATTTGCCGGAGATTT
TTGAAGCAAACAGCGTTGAAACCTTGGAACTGTTTTCCCTGCCATCTATA
TTCCCAGTAGCAAATCGACCGGGACTCCATGAAGTTGAGATTCTGGAACG
CGCCAGGAAACGATGGGCCTTTAGTGATGCCCTAAAGATTCACTTCAAAA
ACCTACTTCAAGACGCCAGGAAAGTGGCGATAAAAACAGAGCTCAAGGAG
ATTTTGGAGGCCATTGAATGGGAGCAGTGGATACAGCGTGAGGAGGACAT
TCAAGAGTGCCAGATGATGCGTCTCCAGATCGTGATTAAAATGTTTGATA
AGCGGGAGAAGGAGATGCACACCGCTTCAAAGACTCGAATCGAAACAGCC
TGCGAGCGAATCGAGAAGCGACGTCAGGCGGGTTTGCGAAAAAACGAGAT
CGAGTTCCAACGGGGAATGCGCCGAATGGAGTTCCAACTTACGAAGAATC
CGCGAAGGTGGGAGAAGCAAAGTCCCATGTACGCGTTGGGATCACCCAGC
TCGGAGTTCTACGCTCCGCTTTTAAGATACGGCGTGGATCCGGCGCGTCG
CAACTTTGTGTCCAAAACAGCACAAAAAGCCTTCGATATGAGAATCGATG
ACTTAGAGAAGCGAATCAACAATACCGACTTCAAATGTCCGTTTAGAAAG
CTTAAGGATTGGTCCAAGCCCAAAAAGTATGACAAGGAATATGAGCGGAA
CTTCTGCAAGGAAGACAATCTACAAAAGCTCTTCGAATCTCTGAAAGGCC
TAAGAACACAGGCCAATGCGGAGAGAGAAGAACCAAAATGTCTAGTACGG
CGAAGAAAACCCGAATTGGGTAGAGCGGCATCCCAAATAACCCTGGCCTA
TCTAACTGACTTGTACGAAAGGAGCGATTCTGATGAGGAATATCGTAAAT
CGCGAGCTTACGGATCCTTTTCACCACACGCAAAGCCGGGGACGAACAAA
GTCTCAGAGACCACACTATCGCATTTGAAGAACGACAGGAAGCGCGAAGA
AATGGAGCACATGTTGAACATTTATGAGGGCACCTACGTGGGTTGGGTGA
TGCAGTTCCTCTCGGAGGAGATGACCCGACTTTCGGAGCTGCGAAGGCTT
CACTTCTTCTCGATTATGGCCCAAAAGGAACGCTGGAGACGCGAGGCCGC
CGAAGCCGGTCTGCGACAGAAGGAGAACGAATTGAGATTGTTGTACGAGG
AGCTTTTCCAACATTGCAATGTGGTCAACAATGAGATCTCCAATAAGTAT
TTTGCCAACATTCTGAGCTCTGATATGTACGGCATGGCCGATGGCCTTGC
TGGCGAGACAGTGAGTGAATTGGCCAAAAAGATCGATGCGGATATATTGC
GATGGCTAGAGAGCTTTAAGTTGATCCAAAACCCCCTTACCTATGTGCCA
CTACGAATAATGTTGAATGACATGATTTCACCGAATATGAACAATATTCT
GCAGCGCTACGAGAATTCCCTGATCGCCCAGTACGTATTGGAGGATGTGA
TTTTCCCAAAGGTGTGGAATGAACTAGATCCGTTTGATATAGGATGTACT
TTAACGAGTGATCTCATAGATCGCCTAATCGACAACGATTTGTATCTGAT
GTCCACTGACAGCGAAAGTGAAACCCCACAAAAAACTTCCTGGCGCGAAG
CTCATGCCATCATAAGAAAGATCATACGACAGGCAGTTCCTGGCGATCGT
TGGCTTCAAGAAAATGAGCGTATTGTTAACGAAAACTATAATGATCTATT
TGACGACGTGTTCGCAGGCATATTTGACAAGTCTGAAAATCCTCCAGCCG
TGAGGCCATCACAACTAATCGAGCTCTGCCCTACTGTCTCTCATAATTAC
ATTCATCACATGGACAATATACGCGAGATGGAAAACTTTCATACCGAAAA
TGCTACCTCACAGCCAGGATCAGAATTTGAAAAAAAACAGTTGTTAAACA
TATTAAGAAAACGCAAAGAAGACAATATTACAAGAAATTTACAAAACTTT
GATAATCCCCTGGCGGGTGAAATACCATCTGACAGCGACATATTTCTAAG
ATCTCAAATATTCAATCCAATGCCACTTCCAACGACGACACCAAGTGATT
TGTTCAGTCTTAGAAGCACTCTCGATGTTTCGCATGCCTCAAAATTGGGA
TCATTTGTCGGCAGGGGCTATAGAGTAATGCTTCCCAGTGAGGAAGAAAA
AAATTCTAACGTTGATGTATCAAAACTTCCGATAGATAATGACGAGGAAG
AAAAATTTGAATTGCCAGCTTCAGAGTTTTCTGAAATTACAGGGACTGAT
ATAGACTCGCCGAAGGTATCATTTCATAAAATTCTGTCGACAATGGAATT
GAGGACGAGGATTTCATCAGCATCTGAATCGCACGATAAGCAACCAGAAG
AAGAGAATTTAAAACCACTGGATTCATCTCCATTAAAATTAGAAAGCTTA
ACCACCCCATCTCCTGGTGAAGCGAAAACTAGAGACTCCCCTTCAGTTGA
ATTAAAGCCGGTTACTGAATTAGTTTCTGAGAATGTAATACCCACCACTT
CCTTGGGTACTAGTAGTATAATAACCAACGATACAAACACAACAACAAAC
GATTTAGACCAAGAAAAGGAAACGTCTAGGGAAATGCGCTCGGTAGTCGA
GTTCAATCTTGAGCCTCTAAACAGACCGGAAGCCGAACTCGGACTGGATG
CCGAACTCGGACCGGATCTCGAAGACGAACCGGGATCCGAACTTTTGCTC
TGGCCAGAACGGGAGTCCTTTATCCCACCCGTACGTTCGTCGGGGGTCAG
AAATTCAACAGTCGAACCGATTAAATCTGAGAAAGGATCGCATTCTTCTA
AAAGGCCTAGAAATAAATCCATAACCGATCAATATGAAGTTGAGGAAAGA
TATATTGGCTCCGTGAGCAAGAACCATATCCAAATTAAGGACAAAACCGC
TGAGAACATAGATAATATTGTACCAGAATCTGAATAAAAACTAAAAATGT
GTGCTGAAAAGAGAAAAAAAAAAAAAAAAAAAAAAAAA

FI06328.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-RA 3635 CG15143-RA 55..3569 1..3515 17575 100 Plus
CG15144-RA 3009 CG15144-RA 721..898 668..845 410 82 Plus
CG15144.a 3316 CG15144.a 967..1144 668..845 410 82 Plus
CG15144-RA 3009 CG15144-RA 1963..2162 1919..2118 235 74.5 Plus
CG15144.a 3316 CG15144.a 2209..2408 1919..2118 235 74.5 Plus
CG15144-RA 3009 CG15144-RA 1201..1283 1148..1230 175 80.7 Plus
CG15144.a 3316 CG15144.a 1447..1529 1148..1230 175 80.7 Plus
CG15144-RA 3009 CG15144-RA 1629..1746 1585..1702 155 75.4 Plus
CG15144.a 3316 CG15144.a 1875..1992 1585..1702 155 75.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17519504..17522559 3513..458 15280 100 Minus
chr2L 23010047 chr2L 17522619..17522858 459..220 1200 100 Minus
chr2L 23010047 chr2L 17522939..17523161 223..1 1115 100 Minus
chr2L 23010047 chr2L 17526041..17526703 1230..568 615 72.9 Minus
chr2L 23010047 chr2L 17529784..17529992 924..716 340 77.5 Minus
chr2L 23010047 chr2L 17528464..17528861 2247..1850 310 71.9 Minus
chr2L 23010047 chr2L 17525090..17525361 2190..1919 250 72.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-RA 3459 CG15143-PA 1..3459 29..3487 17295 100 Plus
CG15144-RB 3117 CG15144-PB 729..1391 568..1230 615 72.9 Plus
CG15145-RA 2631 CG15145-PA 718..926 716..924 340 77.5 Plus
CG15144-RB 3117 CG15144-PB 2071..2342 1919..2190 250 72.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-RA 3513 CG15143-RA 1..3513 1..3513 17565 100 Plus
CG15144-RB 3362 CG15144-RB 856..1518 568..1230 615 72.9 Plus
CG15145-RA 2787 CG15145-RA 718..926 716..924 340 77.5 Plus
CG15144-RB 3362 CG15144-RB 2198..2469 1919..2190 250 72.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-PA 1152 CG15143-PA 1..1152 29..3484 5868 100 Plus
CG15144-PB 1038 CG15144-PB 123..1003 203..2806 2259 52 Plus
CG15145-PA 876 CG15145-PA 16..829 47..2479 2038 50.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17520890..17523947 3515..458 15290 100 Minus
2L 23513712 2L 17524007..17524246 459..220 1200 100 Minus
2L 23513712 2L 17524327..17524549 223..1 1115 100 Minus
2L 23513712 2L 17527429..17528091 1230..568 615 72.9 Minus
2L 23513712 2L 17531172..17531380 924..716 340 77.5 Minus
2L 23513712 2L 17529852..17530249 2247..1850 310 71.9 Minus
2L 23513712 2L 17526478..17526749 2190..1919 250 72.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17520890..17523947 3515..458 15290 100 Minus
2L 23513712 2L 17524007..17524246 459..220 1200 100 Minus
2L 23513712 2L 17524327..17524549 223..1 1115 100 Minus
2L 23513712 2L 17527814..17527991 845..668 410 82 Minus
2L 23513712 2L 17531172..17531380 924..716 340 77.5 Minus
2L 23513712 2L 17526550..17526749 2118..1919 235 74.5 Minus
2L 23513712 2L 17529852..17530039 2247..2060 235 75 Minus
2L 23513712 2L 17527429..17527511 1230..1148 175 80.7 Minus
2L 23513712 2L 17526966..17527083 1702..1585 155 75.4 Minus
Blast to na_te.dros performed on 2014-11-27 11:42:33 has no hits.

FI06328.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:53:59 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17522941..17523134 28..221 100 -> Minus
chr2L 17522619..17522856 222..459 100 <- Minus
chr2L 17519843..17522557 460..3174 100 <- Minus
chr2L 17519504..17519774 3243..3513 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:34 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3459 29..3487 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:23 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3459 29..3487 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:47 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3459 29..3487 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:59 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3459 29..3487 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:25 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3513 1..3513 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:23 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3513 1..3513 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:47 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3513 1..3513 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-14 11:15:39 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3513 1..3513 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:59 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 1..3513 1..3513 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:53:59 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17524329..17524549 1..221 100   Minus
2L 17524007..17524244 222..459 100 <- Minus
2L 17520892..17523945 460..3513 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:47 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17524329..17524549 1..221 100   Minus
arm_2L 17524007..17524244 222..459 100 <- Minus
arm_2L 17520892..17523945 460..3513 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:14 Download gff for FI06328.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17524329..17524549 1..221 100   Minus
2L 17524007..17524244 222..459 100 <- Minus
2L 17520892..17523945 460..3513 100 <- Minus

FI06328.pep Sequence

Translation from 1 to 3486

> FI06328.pep
KYKNIKKNTMSKHNTRLDRHVKFRILQEDRLQSPRQKEDNIKRKKSTSKS
ENLTERGLSSCLINSSVDLRITGGENDPAQRNVGKLPRTDSECQFKAPGY
RFLTEQDTTVNTHEVKMSPRVVTKKDLRHKCDFFAKNKDARPFKNKITQT
LYRESSAQTMAYLPEIFEANSVETLELFSLPSIFPVANRPGLHEVEILER
ARKRWAFSDALKIHFKNLLQDARKVAIKTELKEILEAIEWEQWIQREEDI
QECQMMRLQIVIKMFDKREKEMHTASKTRIETACERIEKRRQAGLRKNEI
EFQRGMRRMEFQLTKNPRRWEKQSPMYALGSPSSEFYAPLLRYGVDPARR
NFVSKTAQKAFDMRIDDLEKRINNTDFKCPFRKLKDWSKPKKYDKEYERN
FCKEDNLQKLFESLKGLRTQANAEREEPKCLVRRRKPELGRAASQITLAY
LTDLYERSDSDEEYRKSRAYGSFSPHAKPGTNKVSETTLSHLKNDRKREE
MEHMLNIYEGTYVGWVMQFLSEEMTRLSELRRLHFFSIMAQKERWRREAA
EAGLRQKENELRLLYEELFQHCNVVNNEISNKYFANILSSDMYGMADGLA
GETVSELAKKIDADILRWLESFKLIQNPLTYVPLRIMLNDMISPNMNNIL
QRYENSLIAQYVLEDVIFPKVWNELDPFDIGCTLTSDLIDRLIDNDLYLM
STDSESETPQKTSWREAHAIIRKIIRQAVPGDRWLQENERIVNENYNDLF
DDVFAGIFDKSENPPAVRPSQLIELCPTVSHNYIHHMDNIREMENFHTEN
ATSQPGSEFEKKQLLNILRKRKEDNITRNLQNFDNPLAGEIPSDSDIFLR
SQIFNPMPLPTTTPSDLFSLRSTLDVSHASKLGSFVGRGYRVMLPSEEEK
NSNVDVSKLPIDNDEEEKFELPASEFSEITGTDIDSPKVSFHKILSTMEL
RTRISSASESHDKQPEEENLKPLDSSPLKLESLTTPSPGEAKTRDSPSVE
LKPVTELVSENVIPTTSLGTSSIITNDTNTTTNDLDQEKETSREMRSVVE
FNLEPLNRPEAELGLDAELGPDLEDEPGSELLLWPERESFIPPVRSSGVR
NSTVEPIKSEKGSHSSKRPRNKSITDQYEVEERYIGSVSKNHIQIKDKTA
ENIDNIVPESE*

FI06328.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15095-PA 2556 GF15095-PA 1..804 71..872 2417 56 Plus
Dana\GF15094-PA 1033 GF15094-PA 96..919 57..876 2326 54.1 Plus
Dana\GF15095-PA 2556 GF15095-PA 1799..2534 54..794 2290 60.6 Plus
Dana\GF15093-PA 830 GF15093-PA 14..736 23..764 1894 50.7 Plus
Dana\GF15095-PA 2556 GF15095-PA 993..1724 153..892 1830 50.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21736-PA 1146 GG21736-PA 1..1146 10..1161 4510 74.1 Plus
Dere\GG21735-PA 1004 GG21735-PA 46..924 27..902 2395 53.4 Plus
Dere\GG21734-PA 848 GG21734-PA 16..764 16..758 2043 53 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10151-PA 1082 GH10151-PA 69..918 42..877 2168 50.9 Plus
Dgri\GH23862-PA 924 GH23862-PA 9..760 125..877 1975 52.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-PA 1152 CG15143-PA 1..1152 10..1161 5959 100 Plus
CG15144-PB 1038 CG15144-PB 123..1003 68..935 2259 52 Plus
CG15145-PA 876 CG15145-PA 16..829 16..826 2038 50.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22366-PA 1136 GI22366-PA 51..910 36..885 2143 50.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15911-PA 1005 GL15911-PA 78..923 56..912 2381 55.1 Plus
Dper\GL15900-PA 1064 GL15900-PA 72..942 61..934 2370 54.3 Plus
Dper\GL15922-PA 784 GL15922-PA 41..774 30..790 2198 57.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26097-PA 1005 GA26097-PA 78..927 56..916 2416 55.4 Plus
Dpse\GA13525-PA 808 GA13525-PA 27..805 30..797 2385 59.6 Plus
Dpse\GA26096-PA 1064 GA26096-PA 72..942 61..934 2367 53.9 Plus
Dpse\GA28165-PB 319 GA28165-PB 1..318 505..822 992 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17119-PA 656 GM17119-PA 1..656 501..1161 3071 88.2 Plus
Dsec\GM17117-PA 489 GM17117-PA 1..461 10..470 2302 94.6 Plus
Dsec\GM17115-PA 888 GM17115-PA 1..832 5..826 2100 50.6 Plus
Dsec\GM17116-PA 358 GM17116-PA 46..307 27..289 767 56.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21860-PA 1145 GD21860-PA 1..1145 10..1161 5587 91 Plus
Dsim\GD21859-PA 1001 GD21859-PA 39..945 36..916 2324 51.8 Plus
Dsim\GD21858-PA 888 GD21858-PA 1..832 5..826 2095 50.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20254-PA 815 GJ20254-PA 66..807 41..772 2165 56.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18223-PA 986 GK18223-PA 68..912 57..885 2346 55 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13125-PA 1084 GE13125-PA 1..1083 10..1122 4434 75.5 Plus
Dyak\GE13124-PA 1005 GE13124-PA 46..975 27..948 2348 51.3 Plus
Dyak\GE13123-PA 886 GE13123-PA 16..765 16..762 2012 52.5 Plus

FI06328.hyp Sequence

Translation from 1 to 3486

> FI06328.hyp
KYKNIKKNTMSKHNTRLDRHVKFRILQEDRLQSPRQKEDNIKRKKSTSKS
ENLTERGLSSCLINSSVDLRITGGENDPAQRNVGKLPRTDSECQFKAPGY
RFLTEQDTTVNTHEVKMSPRVVTKKDLRHKCDFFAKNKDARPFKNKITQT
LYRESSAQTMAYLPEIFEANSVETLELFSLPSIFPVANRPGLHEVEILER
ARKRWAFSDALKIHFKNLLQDARKVAIKTELKEILEAIEWEQWIQREEDI
QECQMMRLQIVIKMFDKREKEMHTASKTRIETACERIEKRRQAGLRKNEI
EFQRGMRRMEFQLTKNPRRWEKQSPMYALGSPSSEFYAPLLRYGVDPARR
NFVSKTAQKAFDMRIDDLEKRINNTDFKCPFRKLKDWSKPKKYDKEYERN
FCKEDNLQKLFESLKGLRTQANAEREEPKCLVRRRKPELGRAASQITLAY
LTDLYERSDSDEEYRKSRAYGSFSPHAKPGTNKVSETTLSHLKNDRKREE
MEHMLNIYEGTYVGWVMQFLSEEMTRLSELRRLHFFSIMAQKERWRREAA
EAGLRQKENELRLLYEELFQHCNVVNNEISNKYFANILSSDMYGMADGLA
GETVSELAKKIDADILRWLESFKLIQNPLTYVPLRIMLNDMISPNMNNIL
QRYENSLIAQYVLEDVIFPKVWNELDPFDIGCTLTSDLIDRLIDNDLYLM
STDSESETPQKTSWREAHAIIRKIIRQAVPGDRWLQENERIVNENYNDLF
DDVFAGIFDKSENPPAVRPSQLIELCPTVSHNYIHHMDNIREMENFHTEN
ATSQPGSEFEKKQLLNILRKRKEDNITRNLQNFDNPLAGEIPSDSDIFLR
SQIFNPMPLPTTTPSDLFSLRSTLDVSHASKLGSFVGRGYRVMLPSEEEK
NSNVDVSKLPIDNDEEEKFELPASEFSEITGTDIDSPKVSFHKILSTMEL
RTRISSASESHDKQPEEENLKPLDSSPLKLESLTTPSPGEAKTRDSPSVE
LKPVTELVSENVIPTTSLGTSSIITNDTNTTTNDLDQEKETSREMRSVVE
FNLEPLNRPEAELGLDAELGPDLEDEPGSELLLWPERESFIPPVRSSGVR
NSTVEPIKSEKGSHSSKRPRNKSITDQYEVEERYIGSVSKNHIQIKDKTA
ENIDNIVPESE*

FI06328.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-PA 1152 CG15143-PA 1..1152 10..1161 5959 100 Plus
CG15144-PB 1038 CG15144-PB 123..1003 68..935 2259 52 Plus
CG15145-PA 876 CG15145-PA 16..829 16..826 2038 50.2 Plus