Clone FI07206 Report

Search the DGRC for FI07206

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:6
Vector:pFlc-1
Associated Gene/TranscriptCG9601-RA
Protein status:FI07206.pep: gold
Sequenced Size:1854

Clone Sequence Records

FI07206.complete Sequence

1854 bp assembled on 2009-03-20

GenBank Submission: BT072973.1

> FI07206.complete
CTAGTGAATTTTGGTGTCAATATTAAGCAATGCTCTTATTTATTGATTAA
CCAAAATGTCTATGGCTAAATACCTAAACCGATCCGTTGGAAAAGCTGGC
AAGGATGTGGCCGCCAGGATATGCACCCTTAAACCCACTGAGCCGGAACA
CCATTCTATACACCTGACCGCTGGGGAGAATTTCGTGGGACGCAGCCGGG
AGACCGGCATCCGAGATTCCAAGTGCTCGAAGCGACAGATTCAACTGCAA
GTGGACCTAAAAAAGGCTGTAGTTTCACTTAAAGTCCTGGGAGTTAATCC
CTGCGGCGTCAATGGTCTGATGCTTATGCAGAACGGGGAACGCGAGCTGA
AGCACGGAGACTTGGTGGAGATCGTTTACGGCAGGCATCAGTTCGAGGTC
GTCTTTAACCCTCCACCGGAGTATGACAAGGAGAAAGCTGAGCCGTTGTC
CACAACACTATCACCGTCAGAGAAATCCGAGAGGTGGGACTCATCTGGCA
ATGGTAAGCTGGTTATCTTTACCAGCGTCGGCGTTAAAGGTTCTGAAAAG
ATAGCTGGCTACGACATGGACGGCACCATTATAAAAACAAAATCGGGACT
GGTGTTCCCCAAAAACACCGACGACTGGCAGATCATATTTCCCGAAGTGC
CGGAGAAACTAAAGAATCTCCACAAGGATGGGTTTAAAATCTGTCTCTTC
ACCAACCAAGGAGGCATTGCTCGTGGAAAAATCAACCTAGATGACTTTAA
GGTCAAGATCAAGCATATTGTGGCTAAACTGGGAGTTCCAATTCAAGTAT
TTATAGCCATAGGTGATGGATTTTATCGCAAACCTTTGACGGGAATGTGG
CAGCACTTAAAGAGTGAAATGAATGATGGCGTTGAGATTCAGGAAGATCG
ATGTTTCTTCGTCGGCGATGCAGCCGGAAGACCGGAGACGGGCAAGGGAG
CCACCAAGCGGCGCAAAGATCACTCTTTAGTAGACAGACTTTTTGCAGCC
AACGTGGGAATTTCATTCTACACTCCAGAGGTTCATTTCCTGGGCAAACA
AGTGGAGCAGTGGAATAAGCCGGACTTTGAACCCACTAGCGTTCAGGACC
AAGTATCTCTGCTTGATCCGGATGACTTGACCCTCGATGACCACCCCTGC
GAAATGGTCATCATGGTGGGTCTGCCAGGATCCGGAAAGAGCCACTTTTG
TTCCAGCTTTTTTCAACCGCGGGGCTACAAAATCGTCAATGCAGATACAT
TGGGTAGCACTCAAAACTGCCTGACTGCCTGTAAACGGTTCCTGGACTCG
GGCCAATCATGTGTGGTGGATAACACCAATGTGGATGCAGCTTCTCGAAA
AAAATTCTTGCAGTTGGCCAGCGAAAAGATGATTCCATGCCGCTGCCTTG
TGATGAATGTGCCCGTCGCCCAAGTGAAGCACAATATAGCTTTCCGAGAG
CTATCAGACTCCGCGCGCACCAAGATCAAGGACATGGTATTTAACATGAT
GAAGAAAAAGTACCAGGAACCCGCCCTAGACGAAGGATTTATATCCATAC
ACAAGGTGAACTTTAAGCCCAATTTTGCGGACGAAAAGCAGGAAAAGCTA
TACAAAATGTACTTGGTCGAGAAATAAGGAAGTAAAATAAATTGTATTTA
ATCCAAAGTGAATATACGCTTAGCTATATCGGCGATCAACCAGTCCATGG
AGCTAAGCAGTTTCTCGCCAGTCACTGCACTAACTCCGGCCACCAGCCAA
TGATGTGTGGTGATATCCTCTAGGTGTAGTATCTTTAAATATAAAGTATA
TTAAATGTGTTGTTTCAATAAAAAATCAATGAGAGTGCAAAAAAAAAAAA
AAAA

FI07206.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-RA 1837 CG9601-RA 1..1837 1..1837 9185 100 Plus
Arf84F.a 684 Arf84F.a 512..684 1784..1612 865 100 Minus
Arf84F.b 684 Arf84F.b 512..684 1784..1612 865 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4167674..4169510 1837..1 9170 99.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-RA 1572 CG9601-PA 1..1572 56..1627 7860 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-RA 1856 CG9601-RA 20..1856 1..1837 9185 100 Plus
Arl2-RA 656 CG7435-RA 498..656 1784..1626 795 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-PA 523 CG9601-PA 1..523 56..1624 2684 100 Plus
Arl2-PA 184 CG7435-PA 140..184 1651..1785 227 97.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8341661..8343497 1837..1 9185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8082492..8084328 1837..1 9185 100 Minus
Blast to na_te.dros performed 2014-11-27 07:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 720..767 1832..1784 125 75.5 Minus

FI07206.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:59:00 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4167673..4169510 1..1838 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:07:40 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1572 56..1627 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:41:39 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1572 56..1627 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:36 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1572 56..1627 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:00 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1572 56..1627 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-20 09:49:18 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1837 1..1838 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:41:39 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 1..1837 1..1837 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:36 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 20..1856 1..1837 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:00 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
CG9601-RA 20..1856 1..1837 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:59:00 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8341660..8343497 1..1838 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:36 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4167382..4169219 1..1838 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:16:13 Download gff for FI07206.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8082491..8084328 1..1838 99   Minus

FI07206.pep Sequence

Translation from 55 to 1626

> FI07206.pep
MSMAKYLNRSVGKAGKDVAARICTLKPTEPEHHSIHLTAGENFVGRSRET
GIRDSKCSKRQIQLQVDLKKAVVSLKVLGVNPCGVNGLMLMQNGERELKH
GDLVEIVYGRHQFEVVFNPPPEYDKEKAEPLSTTLSPSEKSERWDSSGNG
KLVIFTSVGVKGSEKIAGYDMDGTIIKTKSGLVFPKNTDDWQIIFPEVPE
KLKNLHKDGFKICLFTNQGGIARGKINLDDFKVKIKHIVAKLGVPIQVFI
AIGDGFYRKPLTGMWQHLKSEMNDGVEIQEDRCFFVGDAAGRPETGKGAT
KRRKDHSLVDRLFAANVGISFYTPEVHFLGKQVEQWNKPDFEPTSVQDQV
SLLDPDDLTLDDHPCEMVIMVGLPGSGKSHFCSSFFQPRGYKIVNADTLG
STQNCLTACKRFLDSGQSCVVDNTNVDAASRKKFLQLASEKMIPCRCLVM
NVPVAQVKHNIAFRELSDSARTKIKDMVFNMMKKKYQEPALDEGFISIHK
VNFKPNFADEKQEKLYKMYLVEK*

FI07206.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16666-PA 522 GF16666-PA 1..522 1..523 2149 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17452-PA 523 GG17452-PA 1..523 1..523 2570 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17419-PA 524 GH17419-PA 1..524 1..523 2036 68.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-PA 523 CG9601-PA 1..523 1..523 2753 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22747-PA 520 GI22747-PA 1..520 1..523 1963 66.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24116-PA 522 GL24116-PA 1..522 1..523 2020 71.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21905-PA 521 GA21905-PA 1..521 1..523 2004 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26347-PA 523 GM26347-PA 1..523 1..523 2633 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20873-PA 523 GD20873-PA 1..523 1..523 2636 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22749-PA 528 GJ22749-PA 1..528 1..523 2064 70.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14099-PA 522 GK14099-PA 1..522 1..523 1906 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24852-PA 523 GE24852-PA 1..523 1..523 2588 91.6 Plus

FI07206.hyp Sequence

Translation from 55 to 1626

> FI07206.hyp
MSMAKYLNRSVGKAGKDVAARICTLKPTEPEHHSIHLTAGENFVGRSRET
GIRDSKCSKRQIQLQVDLKKAVVSLKVLGVNPCGVNGLMLMQNGERELKH
GDLVEIVYGRHQFEVVFNPPPEYDKEKAEPLSTTLSPSEKSERWDSSGNG
KLVIFTSVGVKGSEKIAGYDMDGTIIKTKSGLVFPKNTDDWQIIFPEVPE
KLKNLHKDGFKICLFTNQGGIARGKINLDDFKVKIKHIVAKLGVPIQVFI
AIGDGFYRKPLTGMWQHLKSEMNDGVEIQEDRCFFVGDAAGRPETGKGAT
KRRKDHSLVDRLFAANVGISFYTPEVHFLGKQVEQWNKPDFEPTSVQDQV
SLLDPDDLTLDDHPCEMVIMVGLPGSGKSHFCSSFFQPRGYKIVNADTLG
STQNCLTACKRFLDSGQSCVVDNTNVDAASRKKFLQLASEKMIPCRCLVM
NVPVAQVKHNIAFRELSDSARTKIKDMVFNMMKKKYQEPALDEGFISIHK
VNFKPNFADEKQEKLYKMYLVEK*

FI07206.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9601-PA 523 CG9601-PA 1..523 1..523 2753 100 Plus