Clone FI07209 Report

Search the DGRC for FI07209

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:9
Vector:pFlc-1
Associated Gene/TranscriptTm2-RA
Protein status:FI07209.pep: gold
Sequenced Size:1244

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tm2 2008-12-18 5.12 accounting

Clone Sequence Records

FI07209.complete Sequence

1244 bp assembled on 2008-09-24

GenBank Submission: BT044580.1

> FI07209.complete
AGTGAGCGTGTGCGTTGGATCTTGGGGTCGCTTTCTGGGCTAAGCAACTT
GGTCAGCATCAGTGTTCTCGGGGTTTCGACAGCGTATAGTGTGTTTGAAA
CGCTAAGTGCTTTTTTCCAGTTTTCTTCCCTTGTAAGTCAAAAACAAAAA
CACAAACACCATGGACGCCATCAAGAAGAAGATGCAAGCGATGAAGCTTG
AGAAGGATAACGCCATTGACAAGGCCGACACCTGCGAGAACCAAGCCAAG
GATGCCAACTCCCGCGCCGACAAACTGAACGAGGAGGTGCGCGATCTGGA
GAAGAAGTTCGTCCAGGTGGAGATCGATCTGGTTACCGCCAAGGAGCAGC
TGGAGAAGGCCAACACCGAGCTGGAGGAGAAGGAGAAACTCCTGACCGCC
ACCGAGTCCGAGGTGGCCACCCAGAACCGCAAGGTGCAACAGATTGAGGA
GGATCTGGAGAAGTCCGAGGAGCGCTCGACCACCGCCCAACAGAAGCTGC
TGGAGGCCACCCAGTCGGCCGATGAGAACAACCGCATGTGCAAGGTGCTG
GAGAACCGTTCCCAGCAGGATGAGGAGCGCATGGACCAGCTGACCAACCA
GTTGAAGGAGGCCCGCATGCTGGCTGAGGATGCCGATACCAAGTCCGACG
AGGTCTCCCGCAAGCTGGCCTTCGTTGAAGACGAGCTGGAGGTGGCTGAG
GATCGTGTCCGCTCCGGCGAGTCCAAGATCATGGAGCTGGAGGAGGAGCT
GAAGGTTGTCGGCAACTCCCTGAAGTCCCTGGAGGTGTCCGAGGAGAAGG
CCAACCAGCGCGTGGAGGAGTTCAAGCGCGAGATGAAGACCCTGTCCATC
AAGTTGAAGGAGGCCGAGCAGCGCGCCGAGCACGCCGAGAAGCAAGTGAA
GCGCCTGCAGAAGGAGGTCGACAGGCTAGAGGACGAGTTGGGCATCAACA
AGGACAGGTACAAGTCCCTGGCCGACGAGATGGACTCCACATTCGCCGAA
TTGGCTGGCTACTAAGTTGGCCAACAGTCCCATTATACCAAATCCACACC
AGCAGCGGAGGAAGATGGAGACGACGACGAGATGGAGAACTCTACTAATT
GTAAACGAATATCTCAAATTGATTTGGCCAACACGAAGATCGGCGGCCGC
AGATACCAAGAACAACAACCATTGTGTATGCAATTCTTTATAAATCTATA
TATTTCATAATAAATAAATAACAACAACAAAAAAAAAAAAAAAA

FI07209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2.f 1990 Tm2.f 231..1461 1..1231 6140 99.9 Plus
Tm2.g 2708 Tm2.g 84..1017 1..934 4655 99.8 Plus
Tm2-RC 2143 Tm2-RC 84..1017 1..934 4655 99.8 Plus
Tm2.g 2708 Tm2.g 1445..1744 932..1231 1500 100 Plus
Tm2-RC 2143 Tm2-RC 1445..1744 932..1231 1500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11137022..11137672 106..756 3225 99.7 Plus
chr3R 27901430 chr3R 11139155..11139451 932..1228 1485 100 Plus
chr3R 27901430 chr3R 11137731..11137910 753..932 900 100 Plus
chr3R 27901430 chr3R 11134812..11134918 1..107 520 99.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-RG 855 CG4843-PG 1..855 161..1015 4275 100 Plus
Tm2-RF 855 CG4843-PF 1..855 161..1015 4275 100 Plus
Tm2-RE 855 CG4843-PE 1..855 161..1015 4275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-RA 1228 CG4843-RA 1..1228 1..1228 6125 99.9 Plus
Tm2-RG 1145 CG4843-RG 23..1145 106..1228 5615 100 Plus
Tm2-RE 1892 CG4843-RE 396..1518 106..1228 5615 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-PG 284 CG4843-PG 1..284 161..1012 1275 100 Plus
Tm2-PF 284 CG4843-PF 1..284 161..1012 1275 100 Plus
Tm2-PE 284 CG4843-PE 1..284 161..1012 1275 100 Plus
Tm2-PB 284 CG4843-PB 1..284 161..1012 1275 100 Plus
Tm2-PA 284 CG4843-PA 1..284 161..1012 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15312398..15313048 106..756 3255 100 Plus
3R 32079331 3R 15314527..15314826 932..1231 1500 100 Plus
3R 32079331 3R 15313107..15313286 753..932 900 100 Plus
3R 32079331 3R 15310193..15310299 1..107 520 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15053229..15053879 106..756 3255 100 Plus
3R 31820162 3R 15055358..15055657 932..1231 1500 100 Plus
3R 31820162 3R 15053938..15054117 753..932 900 100 Plus
3R 31820162 3R 15051024..15051130 1..107 520 99 Plus
Blast to na_te.dros performed 2014-11-27 11:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy10 6006 gypsy10 GYPSY10 6006bp 691..757 1161..1226 143 70.1 Plus

FI07209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:28:15 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11139156..11139451 933..1228 100   Plus
chr3R 11137733..11137910 755..932 100 -> Plus
chr3R 11137024..11137670 108..754 99 -> Plus
chr3R 11134812..11134918 1..107 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:00 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RB 1..855 161..1015 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:41 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RB 1..855 161..1015 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:18 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RB 1..855 161..1015 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:28:15 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RE 1..855 161..1015 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:51:46 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RA 1..1228 1..1228 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:41 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RA 1..1228 1..1228 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:18 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RA 1..1228 1..1228 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-24 18:41:46 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RA 1..1228 1..1228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:28:15 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
Tm2-RA 1..1228 1..1228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:28:15 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15314528..15314823 933..1228 100   Plus
3R 15313109..15313286 755..932 100 -> Plus
3R 15312400..15313046 108..754 100 -> Plus
3R 15310193..15310299 1..107 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:18 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11140250..11140545 933..1228 100   Plus
arm_3R 11138831..11139008 755..932 100 -> Plus
arm_3R 11138122..11138768 108..754 100 -> Plus
arm_3R 11135915..11136021 1..107 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:44:17 Download gff for FI07209.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15055359..15055654 933..1228 100   Plus
3R 15053940..15054117 755..932 100 -> Plus
3R 15053231..15053877 108..754 100 -> Plus
3R 15051024..15051130 1..107 99 -> Plus

FI07209.pep Sequence

Translation from 160 to 1014

> FI07209.pep
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKF
VQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLE
KSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKE
ARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELKVV
GNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQ
KEVDRLEDELGINKDRYKSLADEMDSTFAELAGY*

FI07209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11475-PA 284 GF11475-PA 1..284 1..284 1321 94 Plus
Dana\GF11453-PA 902 GF11453-PA 651..899 61..281 485 49.4 Plus
Dana\GF11453-PA 902 GF11453-PA 1..78 1..78 182 53.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16909-PA 284 GG16909-PA 1..284 1..284 1407 99.6 Plus
Dere\GG16908-PA 769 GG16908-PA 517..765 61..281 578 55.4 Plus
Dere\GG16908-PA 769 GG16908-PA 1..78 1..78 183 53.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18858-PA 284 GH18858-PA 1..284 1..284 1322 94 Plus
Dgri\GH18857-PA 983 GH18857-PA 566..816 61..283 564 54.6 Plus
Dgri\GH18856-PA 113 GH18856-PA 1..78 1..78 178 53.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-PG 284 CG4843-PG 1..284 1..284 1384 100 Plus
Tm2-PF 284 CG4843-PF 1..284 1..284 1384 100 Plus
Tm2-PE 284 CG4843-PE 1..284 1..284 1384 100 Plus
Tm2-PB 284 CG4843-PB 1..284 1..284 1384 100 Plus
Tm2-PA 284 CG4843-PA 1..284 1..284 1384 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22929-PA 284 GI22929-PA 1..284 1..284 1321 94.4 Plus
Dmoj\GI22927-PA 914 GI22927-PA 508..758 61..283 517 50.6 Plus
Dmoj\GI22928-PA 100 GI22928-PA 1..78 1..78 177 53.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12543-PA 1005 GL12543-PA 550..772 82..283 521 52.9 Plus
Dper\GL12541-PA 102 GL12541-PA 1..86 1..86 182 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Tm2-PB 284 GA18472-PB 1..284 1..284 1392 98.2 Plus
Dpse\Tm2-PA 284 GA18472-PA 1..284 1..284 1322 93.7 Plus
Dpse\Tm1-PE 285 GA30232-PE 1..281 1..281 744 61.6 Plus
Dpse\Tm1-PC 511 GA30232-PC 1..281 1..281 725 60.1 Plus
Dpse\Tm1-PB 704 GA30232-PB 497..700 78..281 574 64.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24216-PA 284 GM24216-PA 1..284 1..284 1340 95.4 Plus
Dsec\GM24215-PA 732 GM24215-PA 504..728 78..281 524 52.9 Plus
Dsec\GM24215-PA 732 GM24215-PA 1..78 1..78 183 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15159-PA 300 GD15159-PA 1..257 1..257 1262 100 Plus
Dsim\GD19006-PA 732 GD19006-PA 504..732 78..284 640 62.9 Plus
Dsim\GD19006-PA 732 GD19006-PA 1..78 1..78 183 53.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23212-PA 284 GJ23212-PA 1..284 1..284 1318 94 Plus
Dvir\GJ23210-PA 911 GJ23210-PA 580..830 61..283 511 50.2 Plus
Dvir\GJ23211-PA 99 GJ23211-PA 1..78 1..78 177 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13797-PA 284 GK13797-PA 1..284 1..284 1320 94 Plus
Dwil\GK13796-PA 820 GK13796-PA 568..816 61..281 531 51 Plus
Dwil\GK13795-PA 87 GK13795-PA 1..78 1..78 177 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Tm2-PA 284 GE24292-PA 1..284 1..284 1409 100 Plus
Dyak\Tm1-PA 703 GE24289-PA 475..699 78..281 573 57.8 Plus
Dyak\Tm1-PA 703 GE24289-PA 1..105 1..114 186 44.7 Plus

FI07209.hyp Sequence

Translation from 160 to 1014

> FI07209.hyp
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKF
VQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLE
KSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKE
ARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELKVV
GNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQ
KEVDRLEDELGINKDRYKSLADEMDSTFAELAGY*

FI07209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Tm2-PG 284 CG4843-PG 1..284 1..284 1384 100 Plus
Tm2-PF 284 CG4843-PF 1..284 1..284 1384 100 Plus
Tm2-PE 284 CG4843-PE 1..284 1..284 1384 100 Plus
Tm2-PB 284 CG4843-PB 1..284 1..284 1384 100 Plus
Tm2-PA 284 CG4843-PA 1..284 1..284 1384 100 Plus