Clone FI07236 Report

Search the DGRC for FI07236

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:36
Vector:pFlc-1
Associated Gene/Transcriptantdh-RA
Protein status:FI07236.pep: gold
Sequenced Size:965

Clone Sequence Records

FI07236.complete Sequence

965 bp assembled on 2009-10-06

GenBank Submission: BT099961.1

> FI07236.complete
GAATCATCGTTGAAATCGCAATCGAAAATCATGGAACGCTGGCAGAATCG
CGTGGCCGTCGTCACTGGCGCCAGTTCGGGCATCGGATCGGCCATAGCCA
AGGATCTGGTCCTAGCCGGAATGACGGTGGTGGGTCTGGCCCGACGTGTC
GATCGCGTCAAGGAGCTGCAGAGGGAGCTGCCGGCGGAGAAGCGCGGCAA
ACTTTTTGCCCTCTACTGCGACGTGGGCAACGAGAGTTCCGTAAACGAGG
CCTTCGATTGGATCATCCAAAAGTTGGGCGCCATCGATGTGCTGGTCAAC
AATGCCGGCACCCTGCAACCCGGCTATCTGGTGGACATGAATCCGGCCGT
AATGCAGCAGGTATTGCAGACGAACATCATGGGCATCGTGCTGTGCACCC
AGCGAGCGGTGCGTTCCATGCGGGAGCGCAAGTTCGACGGCCATGTGGTG
CTCATCAATAGCATCCTGGGGCACAAGACCATGACGGCCACGGAGGGCGT
GGCGCCCGATGTGAACGTCTATCCGCCCAGCAAGCATGCAGTTACAGCGC
TGGCCGAAGGATATCGCCAGGAGTTCTTCGGCCTGGGCACCCGCATCAAG
ATTACGAGCGTCAGTCCGGGCGTGGTGGACACGGAGATCGTGCCGGACAG
CATTAGGGAGGCCATCAAGGATCGAATGCTCCACTCCGAGGACATCGCAC
AGGGAGTGCTGTACGCCATCGCCACACCGCCACATGTCCAGGTGCACGAG
CTGATCATCAAGCCACTTGGCGAGACCATGTAGGCGGAGGAGCTTCAGGA
GCTCTGTTCTTTTTTTTTTTGTATTTTTCCTCTTCATCTTAATATTTTTG
CCGTGACAGAAAATATGAAGCACCATATTCACACAATTTTCGTAGACAGT
TTAATATTCACAGTTAAGCTATACACGTTGCAATAAAACTATTTAAATTT
AAAAAAAAAAAAAAA

FI07236.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-RA 1136 antdh-RA 134..1086 2..953 4725 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11059707..11060311 606..2 3025 100 Minus
chrX 22417052 chrX 11059283..11059628 950..606 1680 99.7 Minus
chrX 22417052 chrX 8865794..8865932 169..31 200 76.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-RA 753 CG1386-PA 1..753 31..783 3765 100 Plus
CG10962-RB 750 CG10962-PB 1..139 31..169 200 76.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-RA 950 CG1386-RA 1..950 2..950 4700 99.9 Plus
CG10962-RB 1074 CG10962-RB 29..167 31..169 200 76.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-PA 250 CG1386-PA 1..250 31..780 1263 100 Plus
CG40485-PB 247 CG40485-PB 1..245 31..774 697 54.4 Plus
CG40486-PC 247 CG40486-PC 1..245 31..774 694 54.8 Plus
CG40486-PB 247 CG40486-PB 1..245 31..774 694 54.8 Plus
CG10962-PB 249 CG10962-PB 1..247 31..774 618 49 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11168454..11169058 606..2 3025 100 Minus
X 23542271 X 11168027..11168375 953..606 1695 99.7 Minus
X 23542271 X 8974089..8974227 169..31 200 76.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11176552..11177156 606..2 3025 100 Minus
X 23527363 X 11176125..11176473 953..606 1705 99.7 Minus
Blast to na_te.dros performed 2014-11-27 03:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 990..1036 849..803 118 72.3 Minus
Dbuz\BuT1 769 Dbuz\BuT1 BUT1 769bp 625..657 835..803 111 81.8 Minus

FI07236.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:27:57 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11059707..11060311 1..606 99   Minus
chrX 11059283..11059627 607..950 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:49 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..753 31..783 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:18 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..753 31..783 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:37 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..753 31..783 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:27:57 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..753 31..783 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 14:14:55 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..950 2..950 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:17 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..950 2..950 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:37 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..950 2..950 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:27:57 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 1..950 2..950 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:27:57 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
X 11168454..11169058 1..606 99   Minus
X 11168030..11168374 607..950 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:37 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11062487..11063091 1..606 99   Minus
arm_X 11062063..11062407 607..950 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:56 Download gff for FI07236.complete
Subject Subject Range Query Range Percent Splice Strand
X 11176552..11177156 1..606 99   Minus
X 11176128..11176472 607..950 99 <- Minus

FI07236.pep Sequence

Translation from 0 to 782

> FI07236.pep
ESSLKSQSKIMERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRV
DRVKELQRELPAEKRGKLFALYCDVGNESSVNEAFDWIIQKLGAIDVLVN
NAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFDGHVV
LINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIK
ITSVSPGVVDTEIVPDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHE
LIIKPLGETM*

FI07236.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22361-PA 250 GF22361-PA 1..250 11..260 1213 89.6 Plus
Dana\GF22156-PA 248 GF22156-PA 1..246 11..258 722 55 Plus
Dana\GF22157-PA 250 GF22157-PA 1..248 11..258 656 49.8 Plus
Dana\GF10960-PA 252 GF10960-PA 1..250 11..258 650 51.4 Plus
Dana\GF19119-PA 249 GF19119-PA 1..247 11..258 640 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18873-PA 250 GG18873-PA 1..250 11..260 1266 93.6 Plus
Dere\GG17505-PA 247 GG17505-PA 1..245 11..258 722 54 Plus
Dere\GG17506-PA 247 GG17506-PA 1..245 11..258 713 56.5 Plus
Dere\GG19013-PA 249 GG19013-PA 1..247 11..258 631 48.6 Plus
Dere\GG13756-PA 252 GG13756-PA 1..250 11..258 617 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12229-PA 250 GH12229-PA 1..248 11..258 946 70.6 Plus
Dgri\GH12228-PA 247 GH12228-PA 1..245 11..258 913 69 Plus
Dgri\GH12862-PA 247 GH12862-PA 1..245 11..258 721 54.4 Plus
Dgri\GH12070-PA 249 GH12070-PA 1..247 11..258 669 52.4 Plus
Dgri\GH18905-PA 250 GH18905-PA 1..248 11..258 640 52.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-PA 250 CG1386-PA 1..250 11..260 1263 100 Plus
CG40485-PB 247 CG40485-PB 1..245 11..258 697 54.4 Plus
CG40486-PC 247 CG40486-PC 1..245 11..258 694 54.8 Plus
CG40486-PB 247 CG40486-PB 1..245 11..258 694 54.8 Plus
CG10962-PB 249 CG10962-PB 1..247 11..258 618 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15762-PA 250 GI15762-PA 1..250 11..260 924 67.6 Plus
Dmoj\GI14956-PA 247 GI14956-PA 1..245 11..258 748 60.1 Plus
Dmoj\GI14955-PA 247 GI14955-PA 1..245 11..258 738 55.6 Plus
Dmoj\GI15562-PA 270 GI15562-PA 1..243 11..254 653 50.8 Plus
Dmoj\GI15259-PA 251 GI15259-PA 1..251 11..260 627 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20303-PA 249 GL20303-PA 1..249 11..260 1125 82.8 Plus
Dper\GL16539-PA 247 GL16539-PA 1..245 11..258 684 53.4 Plus
Dper\GL16537-PA 294 GL16537-PA 52..292 11..258 671 54 Plus
Dper\GL13028-PA 249 GL13028-PA 1..247 11..258 643 50.2 Plus
Dper\GL24037-PA 250 GL24037-PA 1..248 11..258 629 53 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12578-PA 249 GA12578-PA 1..249 11..260 1120 82.4 Plus
Dpse\GA23088-PA 247 GA23088-PA 1..245 11..258 689 53.8 Plus
Dpse\GA23087-PA 294 GA23087-PA 52..292 11..258 667 54 Plus
Dpse\GA21729-PA 250 GA21729-PA 1..250 11..260 642 52.4 Plus
Dpse\GA25891-PA 249 GA25891-PA 1..247 11..258 633 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11256-PA 250 GM11256-PA 1..250 11..260 1309 98 Plus
Dsec\GM10056-PA 247 GM10056-PA 1..245 11..258 695 56 Plus
Dsec\GM13691-PA 249 GM13691-PA 1..247 11..258 636 48.6 Plus
Dsec\GM13047-PA 251 GM13047-PA 1..251 11..260 618 50 Plus
Dsec\GM10850-PA 250 GM10850-PA 1..250 11..260 614 53.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15999-PA 250 GD15999-PA 1..250 11..260 1310 98.4 Plus
Dsim\GD23342-PA 247 GD23342-PA 1..245 11..258 732 55.6 Plus
Dsim\GD19832-PA 250 GD19832-PA 1..250 11..260 650 54.1 Plus
Dsim\GD16091-PA 249 GD16091-PA 1..247 11..258 639 48.2 Plus
Dsim\GD15972-PA 251 GD15972-PA 1..251 11..260 617 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18619-PA 250 GJ18619-PA 1..250 11..260 966 72 Plus
Dvir\GJ18923-PA 247 GJ18923-PA 1..245 11..258 723 54.4 Plus
Dvir\GJ18924-PA 247 GJ18924-PA 1..245 11..258 716 56 Plus
Dvir\GJ15175-PA 249 GJ15175-PA 1..247 11..258 672 52.8 Plus
Dvir\GJ14440-PA 250 GJ14440-PA 1..250 11..260 640 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16521-PA 250 GK16521-PA 1..250 11..260 1010 74 Plus
Dwil\GK19844-PA 249 GK19844-PA 1..247 11..258 723 54 Plus
Dwil\GK20029-PA 264 GK20029-PA 1..234 11..247 660 54 Plus
Dwil\GK14225-PA 250 GK14225-PA 1..248 11..258 651 54.2 Plus
Dwil\GK14224-PA 250 GK14224-PA 1..248 11..258 637 52 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17313-PA 250 GE17313-PA 1..250 11..260 1288 96 Plus
Dyak\GE15259-PA 247 GE15259-PA 1..245 11..258 723 54.8 Plus
Dyak\GE15260-PA 247 GE15260-PA 1..245 11..258 706 56.5 Plus
Dyak\GE17424-PA 249 GE17424-PA 1..247 11..258 640 48.6 Plus
Dyak\GE17599-PA 251 GE17599-PA 1..251 11..260 633 50.4 Plus

FI07236.hyp Sequence

Translation from 3 to 782

> FI07236.hyp
SSLKSQSKIMERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVD
RVKELQRELPAEKRGKLFALYCDVGNESSVNEAFDWIIQKLGAIDVLVNN
AGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFDGHVVL
INSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKI
TSVSPGVVDTEIVPDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHEL
IIKPLGETM*

FI07236.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-PA 250 CG1386-PA 1..250 10..259 1263 100 Plus
CG40485-PB 247 CG40485-PB 1..245 10..257 697 54.4 Plus
CG40486-PC 247 CG40486-PC 1..245 10..257 694 54.8 Plus
CG40486-PB 247 CG40486-PB 1..245 10..257 694 54.8 Plus
CG10962-PB 249 CG10962-PB 1..247 10..257 618 49 Plus